ELF54`4 (44 j j j j/ p p/usr/lib/ld.so.1  !"#%&(*+,.123468:;<=>@BCEGIJKMNOQRTUY[\]_`abcefhijkmnopqstuvwxyz{|}   !#&')*,-/02468:;<>?ABCGHIJKMOPQRSTVWZ[]^`adefikmnpqtuvwy{|}     !"%&()*-./134578:<=>ACDEGIJKLNPRTUVXY\^_abcgjlmoquwx{}~    !#$%&')*-025689:<=?ABCDGHJNOPTUVWZ\]^_`abcdefimoqrtuwxy{~     !"#$%(*,-./2458;<=>?@ABEFHIJKOPQRUWXY[^_abcfhijkmnopqruwyz{|     !"#$%&'(+-.13479:;<?@BDEHIJPQSVWXY[\]^_acdegjlmnpqrsuvxz{|~     !"#$%&'()*-./012345789:;<=>?@BCEHIJKMNOQSVX]^_abdhijkmnoqstuvxy{|} $')-/0579?ADFHLPSVWXZ^dglr~   "$%(+.13579=@DEFLNUXY\_bcghjlorsxz~ #$'+,0269;?@BFHMOQSWZ[]`defhiknprstvyz|  "(+,./1347;>@EFIKLMQRSXY[ghjklnpsvz|} &')+013679:CDGLMNSTVZ\]`deglstvx}~ )*,/02568=>ACFGKLMNORTUZ`bfhikotwy} +,6ADFGLPRTUWYZ[\`cefglprwz~ 8$ 9, &gh F x V$ k  d A t jB@  p %@ 40I ^ VTx w k~}P %\ H0 p     a  t ( mP0t@  k@@  F  ,M, E8 \b p. T ;px   Pt   ooD x M  0. !7t AH Ud4 f t,  |  @ L B   k 4  q@ T8 ,]` A H@ X QT gL , @  hD ׈  q e| #=( 4, CYDL ^l0 u 0 h [ -L \ fHD  u D * MX <3  T{X o $ ~0 [T p ( [D( $ ` X  8 4P )i4 >H Z lx   p .4 3 8 P 0 P  = * < C _  uP `8  @ .  X gh nl z * p81D8 Cg,  Vx k jPt y 5H  K    $    ,,  s, .AD Cu< [ \( w 8P `H  F 0 TT    )l ?T$ X  k ,  x  @ [ -P@!0  C 7  O T/ g2  t  lT.4 $D  9, h X >  /h A Q8 Z\ o ( h4  D vpT \  u`D  tP !&@ 2{ D 9  W n^ , k zHd (t  4 P  )@ x  8  ,  4 p;  Hp [ t i < >$@  d< p  j   @HX  ͨ 6 , IU `| t q pP 4 p\   lHX   ( " ;T 1ll EH b kk7  xs  0 `  40 vX x(   l + t(\ F\, S h |q\  Ո H  R  [0D   D  l$>d /"| HpL ZP gt x[P |  >P pP D rtX    ?@P ,Oh =j O@, h : {d Lh @T œt  B$  X |L  l 4$ FH V @ aT sh  *`  4 D<   $  q* > V T k\T   \$ D    oH  `  `  Ph 8k J .,L W  m*d h(   @  ?(  wH N vP  St #r 71 D ˠ ^ l8H  o0d  It x \ `@ <  F $ kp+  FX T , g x~h W L0  $ e` |X p0 7<h + 4d <@ R ul ` x  u\4 +$T @  DL (  o tD   ,  2<8 B ] x WT l l 5d,   @d  ը ! g ! x!4  !I` !` s !u4 !`@ !, !w$( ! ,l !l` ! m"(, "J\  "* l "0 ( "Il "` j"z y" { " l" " tX "$ "xHh "b  # I #DT #3xH #O^` #ox #| m#N #˰ #ޤ0 #]DX # # k$X $ | $- T $D5h $Yr $lќ $ X $ n$ Ut $, $h< $ 9P %  %b %) %El %_@ %l R  %\ %  % ,,, % pxL % &d|L & X &8( &H &[ A` &t ,h & o&Dl & &X &:@ &| ' o'( '' < '<0'M 'dt@ 'T4 ' , ' 2x$ ' 'ud| 'l  (8< (   (3P (Ch (] O (l (  (Q|$ (Z ( 8 ( t (p )I( ) )0;  )G\ )[ )o )  )]0 )]\ )A )t 4 *  * $ *+  *Cx0 *U  *p :  *- *Jx  * *6` *` * n*  +L +' +C`H +U DP +dW +u$ + m+H` + Fp + lD + n(+ +K +i$ , x ,.0 ,U n,Z$D ,t$ ,D< ,< ,| ,4 , p0 - j -  -2 @ -J 0 -]P -n -{ m- l- -d -L -@ -  - k. . `  ..)  .N  .c , .vHT . ./h .zP< .\ .q . . u8 / J0 /lX /0 /W90, /k /4 / l/ x/Xx / @  / ߄( /t 0 ?T 0x< 0(7(t 07  0M 0Z4 0l h 0 l 0{X 0l 0  0]h 0 09T 1%, 1? et 1N ! 1` 0 1t, 1DH 1 N8 1 d$ 1@  1t 1 ox1$ 2E$X 2`\ 2)*  2C,#2J , 2j 2uPL 2 , 2p 2|0 28 2  3  3.+x 3= ( 3K8 3` , 3}03P 3 _x 3k 3w4 3px 30, 3 D( 4 P 4t 4 4.< 4GO 4V:@ 4], 4h 4L 4<T 4 Q4 440 4X 5  5!  5C0 5[`( 5i"t 5v 5$ 5AXX 5 u5 8 50| 50( 6 x 60t 6A:LX 6[< 6v  6 `\ 6 p 6 Xx 6p` 6 wL 6 7 ~x< 7+ 7D,, 7Z AX 7k# 7t 7[88 7]L 7` 7  7 o7( 8p 8H 8,m  8Eh` 8X3h 8lfd 8L( 8$ 8ph  87d 8;| 8 8 k(9ްd 9  93 H 9IY0 9_@ 9|l 9 >h 9: 94 9p 9D 9 ` 9 : x:%O, :; :L\ :n : à4 :$ :QX$ : : h:w4 ; +T ;- ;E $ ;_ y ;x ;=d ;, ; wl ;  ;` ;4LL <  <  <6 X  O >d >3 >L >^4t >| > p,> < >B > > ޔ( > > U| ?  ? 'P ?.  ?@$ ?] ( ?  ? P ?  ? q?CD ?  ?  @ @ @ p@'8` @;$ @O, @l^ @z3 @P @. @ X @ w @ m@ pP@ A  A   A$ A8h AR$P Ao  A~wp A< AI AJT AT B kB 0 B$T B7 kdB@  BO)X Bk \ B~ pB oBKpl B9H BUh B m\B o`B k4B$H B XX Cz C kC" o<C-4 CDxH CU lCZ&x Cp $ C, C  C| C` CT C!( D 4 D h D4 xDM Dc sLhDo 4( D, D:H@ Dj D zpp E n4E ( E  EG 4 E^ ? El | E1 E @ E ED Ec E ^A F h Fδ4 F+%t FI[  FX@ Fz\ F Fi\  Ft F,< FP\ G$ G& t0 GC7 G] Go oGu 0 G dGw G * G $ G  G  H d  Hv H+\ H< p HJ0 He kLHl ,d H < H0H8 H}t` H L4 HT4 I#L I,Ҝ I<(, ILfT, I_I IyX IǤ I Ix@ I$x Iϔ J  Jh J$ Q  J0 lJ<B@` JIID J^|d Jv{0 JD J1x J 4 J m J lJ KL K$ K: 8 KP` Kq 6 K tT Kk@ K  K4 K ]tD L <  Lɼl L) uL@ p"LX  Lg Lu, L mL\ L9`, L P` L 8< L l0L xD  M MB M>Ũ Mi RP My  Ml Me M  M0( M M N   N d N%0 NM2 Ne<< N N d N N N| N` N $ O  O,@ O,|h OE lOL @ Oh`  Ol O O$,D O( O p` O h  P  Pp P+\T P@ E| P]/| P~| P4 L P8 PX P p$Pd Q X@ Q xd  Q(Ƅ  QJL Qed Q|8 $ Q Q5L Qp Q  Q  RH R  R8H RTrx( Rh  Rx  R ptR phR l R  R nR!X R {< Rb Rs  S Y S3x, SK80 SfH SzD S0 S mS x Sw( S}X S T H TJ T5 q!T= TJ` T] nTcܬd TtX0 T5  T[L T T` T)H T8h T0x T*Lt U  Ud U&_t U8 T4 UHH Uhl UVX U U<0 U(l U 6t4 U ˸ VLxl V  V4 n@V:xD VK0 V] l<Ve Vw V xV  V#h V  V D W< W 74 W* H W:)x WK vX$W]P@ Wk  Wzv( W ,l@ W  W W x W\ X!HD X7. XK9T  X`< Xk $ X \ Xd X| X/d XI8 XG< Y4  Y { Y/ YG0 Y[ad Yp Y  Y Y  Yv( Y` Ym$| Z 8 Z'wL4 ZF UL\ ZW@ Zo 8 Z h Z^Xl Z$ Z<h Z mZ 8 Z x8  [L [' L [< x,[QxX [j C8 [}q [ 0 [c [ zP [ ) [e8 [ [ kX\]T \ T \23  \Q pD\X q \iL \ \0 \ \L \P  \ \ < ] ll ]' m]0 p]8  ]C Y ]gD  ]| !@ ] < ( ]84 ]@, ]x ] | ]t4 ]; ^ X ^ < ^,| ^CA, ^` $4@ ^t ^ < ^ "p ^6Dh ^  ^ \ ^t _ Sl _]D _$ `, _:9l _Q t _eS, _z H _  _ x _ Dl _48 ` t0`cH `#0 `E `Vݘ `g+x` `vs,\ ` P ` m` p ` `` `-P@`  a L a#" a5;x aM( aeI ayH a na@ a|| a a WxT a olb P| b obL b9 bK  b^ h bmX( bi b@0 b=,8 bP b0c "$ cD, c0H c<Р cIp, cV^8 ck cY cu, c  c  c\ d  d4 d.Ҡ dG  d^ < dm| d~d d8  d d mDd0 d,D dѤP dP( e  e.a e@ q8eJ(@ eVVx en  e D e eK e e9@ f-d f1 fAx| fa` fw>\ f0@ f o f| f` f 9D f g80 g#EP g>  gT*H g` 8  gs`T g A< g~,d g L g   g t h dt 8 $` , $, >ah Y obf  uaD fT 7, ixT (   9( Y   9 L Olx a dL p  l  v, np @ " w 0qL =!\ N f\ a T z T W,@   rt  o6d s0 <` Q& a0 x 4  x kL  7T 7T D * Xh 9(H P  _ v|u7l, , o$ ?h ;8@   ,  d, *WHd ; 6 NN8T iF0  M<D {  x x _D0 i (8d 6S P7T [ ( j@| F,H 4 H z @P Il k0 .  <$ 1 Hx \0p l   T p | -| ,L 9X4 xp iP8 T l  1+x Cf WD i p\o` MH , (< T d H 2  \0 ,`   , n4 mh<k8T ], p ݼ  <h  , ` 1\!` '\9\'\!$%H@J`d4<$Q@ aDd0-`@l !,@I @I@Rth7@t#\\@ adl$S@Ldd` #`d ؀`  @!t)@ސ!x5+@ڐ@ؐa4 @ѐ+/4 @蛖`@ƿ/@ƾ# a؀  @Ʊ@Ʋ*/9@Ƨ!/@Ƥ8` @Ɲb*8 @g @ƌb(@Ƌ5 0 @~@*@t8'@pbL@m"P@k\耢h@d7#@a bp 7L@V@V  7@Mx쀧 @Gbb@C  H@9@9 @0`  @%" `"  @b `@`@p( $耥-@䀐 "  @"뀧` @倧`@p $@c0T 3$(@cPր`T#$ (@ctπ`T9&(@ݐ#Ȁ`@Րc\` +\ \+\!%a`T4@oմ@oT% 4 TTT`44`4@d@o T%`4@ţ`T! 4@Ŝ `<7,  @e-@ōDx`@ń`~+~+@|`t C" @ϘT%#'!``  ̤ܲ@b?1C'" "@@ ؚ% `+`@   @.@oAC@ # @} 2@a`@`@o&㿠`@o#4 "`\4&@&<&@ `^!|@@a@  7\ %\#\%\a$'@ &@N `&J  #a@ː  %h-` &@ġ@n  @   1#\95!!t%@J @/ 7ᬖT @a@2 㿠@ 5@}#\;3aؘa%@J] @k@/@z @V`#@Pa  '\ -\+\-\a%7@[㿠@H   #\;95b"8@%@J" @+0 p7@@.2 㿠\1@@/@- #\"Hlt%@I @ @*+cH@`#@b|  '\)\9\!9\'!;b@㿠0@7 &p@   #\;95b"Ė&@Iɚ @Ґ<p7   @޹@Ԑ2 㿠@ <'`  @  (`%~ (@ 4 @Ր$ ( , +~ ,@ 8 @ǐb$ ,@5/1 #\̘"&#@I @@㿠;bX@@   1#\95#0#(&-@Im @v<7 @@z2 㿠<` `< @° <% 0 0@&0@l& 㿠< 2;`4`/@=8;`41;@5#TcH@P 㿠@Z@931/ #\cp#㜖&`@I @%@B-H@4`` )\!+\5\a5\&;c@㿠`#@    +#\)'c#&q@H @<#pb @ݜ@"$  @   1#\95 #&u@Hš @ː< p7 @@͐2 㿠@@31/ #\`( LT&@H @@ʐ-H@`` )\!+\5\a5\&;`\@Š㿠@   #\;95`p &@Ho @x<p7  @@y2 㿠@@m31/ #\` ̘Ԗ&@HK @Y@v-H@h``#@C`%@>  +\a6;\5\a5\&㿠@<   #\;95a!DL&@H @<pt7  @2@ 2 㿠 -@ 1/@!TH@@753 #\နa&@G @@ 㿠@   #\;95a!ܘ&@G̚ @Ր<t7h  @ϖ@א2 㿠\3@/@Ȑ- #\a&@G @@Ӑ+cH@Ő 2  @D$ b8@D"(b0 &@L d@!@"` '\61\9\!9\'!;pb@o㿠@|   #\;95b"ؘ' @GV @_<p7|  @ܱ@a2 㿠@v/@U-+ #\ c')@G3 @A@^#H@Q /`c@C 4@C#$c, '!@L !@#`#@c` 3\a5\;\;\'a㿠@   #\;95c#ȘЖ'7@F @<pt7T  @܂@2 㿠@7@/-º #\'G@FÚ @ѐ@ '`l@l$`l @` +\a3\5\a5\&9#H@ǁ㿠@Ӑ   1\!5\7\7\&;°`$@㿠;a@@   1#\95˜ \ ,T'm@Fw @`Ú`ฐ )@G @& #\  Ԕ ) @ @BY % +%#!% @p-% bx% Ԑ @'& #\a!)&@ @B; 1OH@ Ē! H@ Ӓ@p& c@L   @k @@㿠 `@[ @ 㿠@L  @$@ 31 !$@ aP@@ #\7;5Òatᘘ)g@A @@ 㿠@_;ct& @@   1#\9/Ô!В!ؖ)v@AŚ @ΐ<  58 @@А2 㿠@ @ " 㿠@ِ@ i@l   @o%q@m?/@ln À  #\`?b )@A~ +@m @gt5 @n@h#\@ b$)@Ad @v &`@o' @l  @o;  "#\Ô"@`Hb,)@ @A: )Ð"P@; -\@61\/\!/\%3cH@H@8 #\9;5Òbh")@A @$@@㿠@B ` 5\7\9\9\'!;ðb@㿠@9"@` @n  ` 9<`( @ #<`(( @@ @: @   /#\-+Ò⤔̘bԖ)@@š @ː#\)'< P% @=$@ʐ"  5Ð@=6  ;@=$b97Ú" )@F  㿠;ðc8@=  /@= P-+Ú@cH )@E @975ú #\#`ㄘ)@@x @@3cH@㿠l;@fiH&l@ cH;@c@<  -@<ڐ+)Úc# *@Eǘ @g   1#\5/Ô#Ș* @@A @JH7 @ @N2 㿠;Đ`@< ;Đ`9@<IJ ` * @E㿠@L   3`@4l@f%l 9@#\;5Ē`( LT*&@? @ @&㿠;c;@`\@ &!&@ @c㿠@l @i/-+İ #\@ T\ad*@>ʚ @Ґ@l@ir J O  `@  @l.@b 㿠/@la-+Ā l#\@ ta|*@> @YM Ԁ  @ @YLĐa@YG `1 75Į7Ĭᔲ +@i#\@ @>_А@bv@b@Y$@bn@l:Ēᤐ@Y `ܐ;Đa@Y @Xؐ@b_& @V㿠@ V`` `N&```&`@ İ@: @ #Ė`a!@:Ěἒ! +0@C| `@" ``@" @` @`خM/@``@ &`@a㿐l ' %#l@h  #\`?b+[1@=Ěl@i?Ā #\$@ b,"4+^@=l@hf5@Ĕ '@ ِl`  ;`@ b@l@c&l@ظ@O?*Đ<@: "e @9bT Ě"DL +v@B Đ@UbĐ@9 Đ@9Ě"b +|@BϘ'%@aq#h&@c@aoh@de #\@ ̘bԖ+@=?@T   1#\/-Ē"ܔ +@=.@7<5 Lh7@@72 㿠l܀`Sl @i!?l@g  #\ Ā c`?#@H+@= @r{@jĐ@g#\ĒPcXc`+@<Đh@@j͒)Đ#p@9b/-Đ+@9Lxc+@B;@b5@`&܀  9@U'#;;@`&`@ϐ 㿠l@b&l@`@`@`;cH@ 㿠@`P@`(`(@,`,@44@ y88@ r@`|@`T 4@`T,@`T`0@`|T@`yX@`v@`s@`pl@bOh@bLD@bI @~ ` @@͗? @|@`R  㿠;9#\7Ā@ c#㴖,C@$8+@]O $L@]K $P@]G H$T"ܔ8 $$@_ $D  #\Dဘ- !\@ @9/"ܔ`8 @_  $hᐔ#\-h;@ @9P`   ``% L$P#`L# T"T"T"`T! T T `T' <@  '`@ἀ 9^+ƔaĐ!@T%?-ƸXbx`&4&4B-@@\ @\$@5$x@\@\$@5$k@\ @\$b$ @\$|[ @T# T (O @T&T (-C4`@\ @\4%8ƐbD @Iі@\D@_b?ƀ #\P@ HbX. @8u  ^@\D@_J? ƀ@  "`#\h"p."@8] -@S?k$& 1@P"@1-@$35c#)@8u";@ TƐ$(@\PT##`4T"8T"`D@\! H$X@\ , $d@\="$@\9$7@t/0 @t+# @t& c@t!$`c|@zژ$@u@A/@rt!\!@9^`@@ڐ@Ԑ@a@ΐ@ܐ@Ȑ{㿠;9#\b;ƔbИ"ܐ )@7Ś 5/-ƶ #\ *@7 @[ " @[Ր%`㿠 @[ @[@[㿘`  @["N `/@['5`@ ;ƒc@O7` @O`@['㿠``@[@v@~@mJ/" N ;`@[z 㿠  @[f/ ' @3ђ 75 3@30c(  @<   @ '  @[H  @ ' 㿘9/#\#<9Ɣ#DP @7 N   ƀ&`&` g@'@["@   @  Ɛ" '@#X@* '#\N!Ɣlcx#\ `?@6'M /@. ;&`7`@OBc`$@ז@Z㿠`@Ov`H@Z`8@{㿠 ;@Z Lb8;`P @y @z" -" @Qn$`@zV$`$`$`@Z$`$$`($`,$`H@z$`8 @Z p@yn`8$`$`$` $`<$`@$`D$` $$$ " 0 " (" 4 " ,㿠 $` @u @@& @@p @Q2㿠@z`@zځ㿠 H& & @ZnV@@ZC`& H㿠;b8 @yk  @@ ? @< $  @Pb@P,`@P@PS@O @PL@P@PE(@y5 @z @P1@P 9 JH*@J  & J` &  `&   `&& ,H @;@PM`l@x H @@P? 㾠  @   @ ! @{R;`@xΐ 㿠  @ ? @ ;Ɛ c;@Ô &a@x 㿘  @   @  @{( ?2O8@zg  q &$;a@x 㿠 &  &  @i ?@e ;7H@z H@c@8@x{ 㿠<@y04@  㿠@y  " @xo㿠`@y@y& ;b@ @{J&  㿠+]`@#9]  @ `7Ʋ@;]-`@ ]#a]a ]a耢 ]ap #Hc#|@#`#`'H'L'P'T'X;@LH`` 53`97ư!p@㿠#@~@`@}@@@}@}@X@~@|㿠 ,@ \@X"`@Xu @㿠;]a쀧`/Ɛ@0  5@0(31ǚ`   @9Θ @7]&9]!㿠;]a쀧`-ǐL@0Ւ 9]31@0`|/ǚ \l  @9 !7]@ &㿠   "  "    ;"  ;ǁ  @3ؐ`?XX`hpx㿠9 #(. @@            5ǐ@3? J `/ `? @< 㿠 #\@9ǐD`71ǒ  ! @3 /-#\+ǀ@  ,a8 @3)ǐ!@@0/ 'ǐ\@0%!ǚH!T  "@9O``k O` `O` *H FO`@` M M?" M *  N` "H `MN`@   N` 2%N` ", 2% N``` N``" O`?O` ? "`N`O`@2  `O`` N``?㿠;9#\a;ǀa@ ! ~@3 7Ǩ @ᰀ5/㐐M`@;2  @  `  㿠 #\9/-ǀF !ȔИܖ @2 +)'ǀ@  a#\! @2ݚ &N> &㿠 @ǔ `"  @㿠7 N㜀㜐O ڔ `@ 8 O 㿠 @ @V  N`N`@/  㿠;ǐb@.  ;9@.b,7ǚ"   A@7ј  @VX㿠;Ǵ #\bT;9ǀFb`"p K7@2J |@.Ӓ  '@.%#ǚb  M@7  +ǐb@.  3@.b/-ǚؖ  R@7 @&  @V8 @V5 @V2 @X F@( @V)㿠;9#\c ;ǀc@ #( l@2   @V& 㿠;#\9ǒc4;ǀc@@ #P x@1  㿠;9#\c\;ǀch@ #x @1ٚ   @U& 㿠;7#\c;ǔc㜐 @1Ú /-+ǀ #\@ cȖ @1@  " %#@g* #\!ǒԔc # @1 @_i @\MȔ @_}㿠;ȶ #\`;9ȀF`  5@1~ /-#\,@ <L @1s `@Ԓ& )'&` 1@X #\@  X `p @1[㿠;#\9Ȓ`|;Ȁ`@   @1L  㿠;#\9Ȓ`;Ȁ`@   @1<  㿠;#\9Ȓ`;Ȁ`ؐ@   @1,  㿠;#\9Ȓ`;Ȁa@ ! @1  㿠;9#\a;Ȁa(@ !8 @1    @U!& 㿠;#\9ȒaD;ȀaP@ !` @0  㿠 @Uא @ @Tj㿠;ȶ #\al;9ȀFax!!5@0 /-#\@ ᠘! @0nk@㿘#\1 d #`;9 X bܖ 5@Vk 3/ȶ #\aȘذ!@0 㿘C@T;ȴa @, Ȑ @,Ț!b!&@5ؘ `39ȶ" 9Ȣ"0"@Z %Ȕ$@H'Ȓ,@H@Tb@,Β-ȐX@,+)Țb<"L!7@5 ``Ր/Ȑ|@, 7Ȑ5@,3Țb !;@5 㿠;Ȑb@,  ;9@,b7Ț"А !D@5z  @T㿠;Ȑc @,  9@,w#475Ț( !M@5d  ` @V @T @S @S F@ @S㿠;ȶ #\cd;9ȀFcp#!_5@/ʚ /-#\@ 㘘!`@/ ``  `@   2: ``26  `   `@   `2! `2  `   `@"    2 ``2  㿠;7#\c;ȀcĐ@ Ԗ!@/c  @i @SZ &   \L\L / R `L` @.L.㿠;Ƞ #\c;7ɀD c!@/+ J 4NN/  K ` K / N`2 NN / `M` M`/`$@ @+N`㿠 ;#\95ɀ` F ,!/@. 8 N / J `/ @<@۔ NN / `K`K``/`N%'ɲ@@ )ɒ D@ N``N` `@ @'/ 㿠@R@ /@/``@ @R@u @R .   &`@Rr`&`@Rj]#a]#a㿠 ` @Į@RZ  #  @gɐ`H@* %% `    ` 77ɖ @*p53ɚT`d "h@3    ` @R"㿠`` @tU@R/ɐ@*  7@*n53ɚ` "}@3[    ;bH@&  " 㿘 7@Q̒  #\7/ɺG "-@- +)#\@ a!,"'@-'`'`'` @g'` $!'!8'@*/  %@*`#1ɚaD!T "@3 '@u@?H@Ŕ`'`5ɐ|@* '  `)   `-  7 ɖ@)ɚaɖa " @2Ϙ!]#\!ɔ! a@ "@-L]] !#P`"  `"  `  㿘'H'L'P'T'X@EH㿠;ɮ b@-ɰ@Q73ɒb @5ɰ$@Q-7ɒ(@ 9ɰ"0@Q#;ɐb4@,m㿠;7ɐb`;@6 b| @5 N" @6 3/ɐb @5" -@6)@5?" #@5'%,@5" @ɐP@AC0?@Yh dlp\`t#\ɀH@ cTcd#?@,  #\ ɒcp㜐 ##@@, @` )Y+ɰ!`c@#x  #p#t`H#|`H,,xp9)̹̩V V23<=T^, P P./ d#x#|(x!ș R*+L#p#tpt@;h @ h #ɐ @;h#hcؒ @5A;h Nh ;ɐc @58;h N" hʒ @50;h ʺ" )`,@5*  h ʐ`H @5!;h?" $@P  ʰh@5 " hʒ  @5;h @5   h5ʐ @5;h% @4 " @4  ʒ$a@=*h;h@O@h/1@;h"ʒʀ  #\@ Px!#{@+Ě  #\` ʐ 79ʒaᤘ!#|#@+ @" @Da@OƐh! @#!5#xH#|H x,`̽ZZ,!̍$%<=P^ R čP#pp77ʮ dȒ @4;h  @$h#@lؖ  @$#\a`#`@f@Os1!`@]a㿠;9#\a;ʀa@ "  Y@+A 7ʰ@'Ȓ  /@'@-+ʚ$b4  [@0  @OG ` @ @O=  @@O4㿘7@oV \@' ʐ@'ʚ"hbx  |@0u `@ ('<# )` @ (/@M /-ʒ@CP@N'` @@N @N /` @z/ʁ @'K  53ʐ@'61ʚb"  @0$  '`x㿠@nѐ;@nܐc@m/ c.   2 %`(@Vu?8  @V#\ ʀ"ؐ@ " @*q?`@QM#\ʀ@  @*a@VN?ݐ $)`  `@@Nh@PH` `@@NZ``%  @mW)@)#@@oD3+1ʴ #\clc# @*" @o0@mL㿠@nN  @㿈 @*  &@N(&$`ʐc@& 75;@&| ʚ#Ȓc !4@/j@m  $@T˞ #\#`!;@)@Nˤ@&e +ː`D'@&Q#˚(`8 !F@/? $@W&$@M \* @ /@ 1/`&@@Mϐ@Mː X&@M@MƐ @M`\&@M@M ` @)@-@M/@M &$@A@M&@ܔ &  E,  @@M @M'ђ \&@Mxːh@% ː@%ђ ˒t! !@.ːa@%ђ !@%!˚ᴖ!Đ !@. ''@nE   1#\/-˒!ܔ!@) @n(#\+75@%kb@n'"`  `@%  ː @%˚`l| !@.nn@M _ \@Mː`@%r   @%]˒ĖԚ !@.J&(@L`'3%[#  1?@O`#\@ a!@( 㿠;@k͒a (` 5 @ & 9ː "8  㿠@h@N;ːbD@%  ;@%bl95˚"P` "@- @L@L 㿠/ˢ #\/-ˀ@D`☘"+@(d )'#\b@ "ĘԖ"%@(X!#\@ ""@(Mːc@$Ւ  @S&˒@$c8˚c, "!@-  @L3 ,@hZ% #\ #h〘#"% @ @(# ]X@h  @L % @L %$ $ '%#%% % f%% @UƐ%$ %(@K  "0 @j͘% #\㜔c̖"A@ @'ޚ @. %`ؔ#\`"C`@ @'њ `@k㾐-/l<(#d  W#h5̀#\F+` Wd@' @k#\@ `LX`l@'@k#\ ̀ |@  @'`0̒#\ฐ@ ̖@' .̐`@$ (\ ̚a@# ̚ ! @,Ә%`H    " H l     "y%̀ yˀ `(`x `````$` ̖#\a,#`!@8Xƨ `(ᠮ$ ̖#\a@#`!@81 `( !Ȯ     $ ̖#\a`#`!@8 x `(a `````$` l̖#\#`!@7P `($ E ̖#\!#`!@7) `( b@      $ ̖#\aȐ#`!@7 ` ``""#\`"4#\F`"\#\#\`45̒a@ @&)`4`8̒,bD@ X@&`8hĀ!`<;̘b"h@ b|@&`<d@z#\/`@3̔bbȖ ⠐@ @%#\`@\b`D5̒؀b@ @%Қ`DM@%`( hl ̖#|!@6(`(  #bp9"tp;̖c!@6`(` 7x"|\̖c!@6՘ /  $@hX $@h@j5͒c̰ #\c@%q@j@h㿐#d #`  #h  #l#\ 㿐#d #` #h  #l#\ 㿐#` #d  #h #l#\t 㿠 H` H@^& H  @io" $ $`  $@ig"  $@h& $㿠;9#\`;̀`@  0 |@% Ӑ@I'㿠;9#\`@;̀`L@  ` @$      @I@I㿠@i@i%" H +`@g (% & @i #\9;7͒`p ਖ @$Ú @iѐ@g㿠 &(;a@gܐ ͐`@!; "B ͐@!'͚ Ȗ`ܐ  @*  !͐!@!%  '@!8%#͚a(  @* @i   -#\+)͒Xa! @$z @i7 &H@i2 㿠;&(c@g` ͐a@  "A !@ Ր!͚ᴖ!Ȑ  @)˜  #͐a@ Ӓ  )@ "('%͚  @) @iN   /#\-+͒Pxb @$( @i17 P&H@i42 㿘';@g7a0;͐b@   @ b;9͚b"  @)u ͔ @Ӗ  ͐#@   @ mL͖#<c(  @)Z  ,'`"'@G&D'͐@ b '%#@ N!͚c#  @)<  @ +͐c@ G  1@ 5 ,/-Κ  @)" 0' @G&H 㿠(`1 d5Β7ȟ X@f 㿠;΢ `@   K!Β@ Κถ ̐ !@(&4)%&8"X&<&@&D@f&,p &(&0&D@f@hy   1#\/-Β!<P!@#S@h\  7< @S&H@hZ2 㿠 F``+< ('  -a` @G9X@f? ΐ@  @aΒ!ᬐ !/@({ : @F L-+" c<  @e՘&$%##\!Β$a"!;@ @" @M'`  #\ ` "0"D!> @ @"Ԛ @P&$@fʐ /ΐT@R 975@>1Κd"x !D@(,  @eِ 㿠  @F L"   p@F7'`@- `@ Κ!c"@(  nΪc@!7`@#PΚ@!k,@'  & ֒ %  &%``@ /* @F `@g2#\`@Fs/@Fxx'`#\`@Fr`@Fg@Fkc|'`#\ ΀〔c@ #!@";-`@FX & `@IJ#\΀@ 㴔cЖ!@"! '`  `@O'`` \`@F/'`#@7'%`@!Ϛ !@'s/<-@d֘&$ +#\)ϒ$$`8 L!@ @!9"P@e $@eߐ 㿠 I @E֒ L` ``@L' `@E ' ' ϔ t#\`\ !@ @!  ` @O' /+` )'`@O5'`$< @d'`$ `#\ `$!@ @! `$@e  㿘 ;cȮ@d  && H %<(! @ @E\ #\-+)ϒД`N !!ـ@ @!^  .@`@g#@UH`/ @GJ /@Bϲ@6a` O`  ϒa @&!"%ϒ@9'$@ /-+ϐX)@a4!H "@&q p@ ;75@paဖ "@&_  㿠 ` ` <`(( @  %ϐa@W  !#ϒ@@aϚؒ!Đ "'@&. -< &`() @; ( K `   dlbD @@D @c  & #\ ϒ"""W  `?@ u Ò &1#\7Ϙ#P5ϒ<"a/@ @ d h@c  %3ϒ.b Ā@Dm 8@cq  㿠@du@d``@WP (/ϐ```@D> (`5P@c@9ϐ#lڐ``@@D*㿠;Ϡ cx@ ϐ@~Ϛ#c "@%k&4' &8#X&<&@&D@c c&,&(&0&D@c@d   1#\/-В#̔"@Қ@dې7 < @Ֆ&H@dܐ2 㿠;Т `@F !|%В@/LК< ( "@%&4)&8"X&<&@&D@bː&,&(&0&D@b@d   1#\/-В p"@@d I7< @&H@d2 㿠@c``@퀁3bP@b9А /@@Cm㿠;Т `@Ւ ! %В@К ܐ "@$&4)&8!&<&@&D@bZ&,&(&0&D@bK@d;   1#\/-В!,Th"@@d 7< @&H@d2 㿠@c1@c<`#Аax@ 1)@i!'%вሶ "ظ @$U`!9 -А@` 혐5@J/жa " @$69"P@a7А4z``@@Bʁ㿠 &4/&8&<&@&D@aА&,&0;ch&(&4@a@c   +#\)'Вb@"h|#@ @c L%  @&H@c2 㿠` ’b@a P@a @Ba L +%#" !" @By-% c<%  @a.&$ #\b"$#@ @B $@b= 㿠@bn ;Аb  @BEp` Ò`@aC   ,$`$к ?'&4&8&<&@&D@a4Ö"t&4&,&0&(@a"@c   /#\-+Вؔc#Z@@b) !  @&H@b2 㿠@b 'А$@Z 쒐-@DX+)вc4#H #f @#0;bP;@`ؐcs  @@A㿠   &4#ä &8` &<&@&D@` &,P&(&0&4@`@b   /#\-+В㘔cԖ#}@y@b`) !` @1&H@b2 㿠;9#\c;Дc #@[ 7ѐ@  !!ђb@ɐ Dњ  4 #@" #ѐ`d@ǒ +)'@ %њt #@" bP@`N@b>/-1Ѵ #\ Ȗ#@ @b*@`F㿠;Ē`@`4 "K  F< ( @ A @`;!ѐ!@ %#'ђ@nD a4 #@"] @a   9#\/-ђ!lᔘ#@ך @a 5`D@@a"   㿠@` ;ѐaz  @@Ɂ㿠1/  ꬸ #\9є!В!Ę#Ǣ@ &4)%&8 d&<&@&D@_&,&(&0&4@_`7 ` `` ` ` `` ' @a   #\#!ј0a"#@a @aj%!` @&H@ai"  㿠@`| 'ѐ@@Β -@t+)њbP"d #@! &`;bP;@_Lb@@@6㿠;Ѹ b@ !ђ@"њⰖ"Đ #@!w&4'#&8<&<&@&D@_$`D&,&(&0&8@_@a   1#\/-ђ"(#@ߚ@` +a! @&H@`2 㿠;Ѹ c8@O ѐl@;њ#Hc\ $@!(&4%Ħ &8!Ţ<&<&@&D@^Ԑ !&,&(&0&8@^Ő@`   1#\/-ђ#㰘Ė$ @@`+a  @&H@`2 㿠@_`  ` @Z`7ѐ<*  @@?zpВ @p 0 _ [  ;Űa&5,@^k  #\+)'Ҁ@ c $4@6#Ҁ #\8@ `L`($5@)&4&8&<&@&D@^N Ɣ|&4 &,&0&(@^< (<  @/Ґ\@ "_ ;1@`7Қl  $D@ s `,Ґ`@|  @j Ғ  $M@ W('И`'(I"-  ('( I'Т'@_   #\;97Ғa !H\$s@ @_Ɛ/Д  @&H@_ǐ2 㿠  H@> L `&7/" x @]w &$)'#\%Ғ!l$ဘ$#ƀ@ @ ah@]$@^ pВ @ 01/ -} #\!1Ҁ@ !Ȗ% +)Ҡ @c#\ؐ@ a!% %@Y&4&8&<&@&D@]~Ǟ|&,`&4&(&0@]m`(< @ Ґb @ʒ" 79@@Қ""0%@  ``-Ґ@"r 3;@b5Қb%@  " Ґc@  @z#LҚ(< %$@g  ''  $''В'`#Ґch@l  '@Z79Қx# %,@G`` ''Ш`'@^   #\Ғ㨔Иc%3@ @^Ð1Д!  @&H@^Đ2 㿠;Ґc@/ ; /-d1Ӓ@ ( %;@ b  @\   @j  & 㿠@] +Ӑ`H@ ?3@`|/-ӲXl %L @݁;Ӹ`6$  @@=s㿠 &41&8-Ǯ!X&<&@&D@\w P&,&0 &(&4@\g` Ӂ `@Ē @ ӒԚ %^@@^>   %#\#!Ӓa,!@%b@@^! a @t&H@^"2 㿠;Ӳ aP@ )'+Ӓ@ta!`t %k@c- @ʔ%@o 97;Ӓ@WaК! %r@F 㿠;9#\a;Ӏa@ " %@š  7 ƀ  F@є @<ҁ㿠 9@<  ,5" "  @S X@[ɐ 㿠;Ӑb @) ;51@T/Ӛ"0D %@ a9@Te&\!X@[ 㿠$`  $@\" $@\>&$00@\6&04 4@\.&4<`<@\&&< @X\\@Q( @\(@]&(@\&(,  @\,@],@\&,8 @\8@] 8@\&8T`T@>%L@6P@6D@<:H@<7@<5 㿠;9#\bl;Ӕbt"&#@     @E @B @E㿠@E ";97Ӡb"☪&<  @B#\@ٚ$@E㿠 $` $@\ H@QD9'`H $@Zߒ  $@Z㿠/Ӣ #\/\-Ӏ@`D`И&i+@ )!#\b@ ##&j/@#\Ӏ@ (c<cP&k@#\ Ӏ@ `cp#&l@#\Ӏ@ c㤘&m@t-#\cȐ@ ؘ&n@ivӮc@ Ԑ`0@ےԚ  &u@Ș3Ԓ`H@  @;D H  ' @;< d@Wc$  #\   `| & @ @, ] |@W $$ $ $ $ @;B $ $ $ $  (`P  ( '#\15 4ࠔ Ԁ&@ @ ( 2.#\ , -Ԑ@ @q/Ԛ`&@^ 0!Ԑad@n@\ Ԓt!&@I  8Ԓb@ b&@ƚ +@: L)@D$``p#<   @Y$ $35#\1ԔbH $\"$&7Ԁ@ @  $@Zʒl@4$ L@49$ P @@O$ \ \㿠;9#\bx;Ԁb@ " k@ 7԰@  5@3/Ԛb̐  m@  @$ @`-אH@u  @cז!la\ "w@P <9@V? @8 ׀ #\@ !!̖"{@ǚ@V 8@VCא!@I  -@77/ך "@$ 4+@U? @8;׀ #\@ bLbTbd"@@U ,@V#׮bx(!׮"$1׮" 3׬ b5׬ ׮b#\ג""@pH` @@@T6`(@Tk&#a(!!$-4 1 !D5 Xah#\ؒ"HL\#X@Hx @: @;`T@6? ؀@  "p#\⬘"#f@  `  ` `` X9ؒ"Д]``@@3 @5{1% !(@R&/@Rx0`g@:La<] <5 0`-0@S@K.L@-L@.-     $ $#\#`(,#d#h#l#pD#t#x <4 (ؠ`" ( $" " "@  +)'@ #%ؚ #@ &4aD@R/ @9-ؐ0@   9@ y#h1/ؚ#DT #@f ,@SՐ ;@;V? " #\@ ㈔c#@ٚ c@ b  @(ؒ ` ` C @ Dc ؒ̚#ܐ #@1  ?1@593ـ #\@  `P `#@ ݨ @)> @(%#\  E@E@$  㿠;@QaD 㿠0@"&04"&40`0@R?&044@R7&4< ;<@R/&<a@J@ x 0`  0@R 4@R L@-3   ` `$` `$#\#``(`,#d#h#l#p `D#t#x  <`` Ā7Ҕܐ  @In㿀;٪ #\`t;@9ٔ` %@  @8&%8@R @   5@ ;#ٚ`Ė`Ԑ % @o&<@RA,@Rv @Cp?@9ܒ? @8#\aـ@ a,%@ ٚ @( `` C@Hِa@@ T @ Bx ٚ!Td% @/-@9ـ #\`?aВ%!1@ `/٪ @(=`@' @(k`@&T`@4t? #\0@ ! %&@ @1` @9pِbD@   5@ |ٚbXh %0@ޘ8@RM DH@d ـ #\@ "И%7@ S  @'{ @'@&D@P @ %%@ ! D@ED@wH@;H@'D@4 @'  @' @ F && @'? D@@ %ِ@  %@ @', ْ@ |#,ٖ# %X@i@&;  B&& @& 4@Q' @' 䀐TT@7 @'X&X T@9;? @0Ȓ @" F " @&"@ @&ߐ"%@%@'H@%?% `@3 ـ #\cp@ #%u@  @Pސ,@Q@&䀧 @%t#Ԛ&D`&@  + )'#\@` # %|@ @&<  㿠;ڤ #\`L;9ڀD`` p v@ O  8 8@E& 8  @P"     @P{"  @O&  `   %  `  ( (@02㾐-/l#d  #h5ڀ#\F+` d@  @P3#\@ `ธ`Ȗ@ @P4#\ ڀ ؐ@  @ `@ڒ#\@ @ ך .ڐa0@] (Ḓ ښa`@0 ښ!@!P @%`8    " H l     "y7ڀ yˀ `4`Ԯ `````$` ,ږ#`a|#\!@Ƥ `4$ ږ#`a#\!@{ `4 "$     $ ސږ#`a#\!@Tx `4bL `````$` ٶږ#`А#\!@,P `4t$ ُ ږ#`!#\!@) `4 b      $ gږ#`b#\!@ݚ ` ``""#\`"4#\F`"\#\#\`D5ڒb@hX@ @ s`D `Hڒ"x b@ ⠖@ _`Hh!`L;ژbԀ"@ bĖ@ J`Ld@{#\/`P3ڔbc @ @ 3#\`P\c)`T5ڔc0#@ @@ `TNP@ Ձ`4 ΐ ږ#!@G(`4 "#bغ9ږ#Ԑ!@3`4` !""ئږc!@  /ܟ @L @L@Nܐ5ے`۰ 8#\`(@ @NȐ@L㿐#d #` #h  #l#\ 㿐\#\  #` #d#h#l 㿐#` #d  #h #l#\s 㿠@M@M" 8  /   H+ܟŀ  @La ,975'`  @N d#\ @ a @No@L㿠;גc8@L},` ې`@ܒ "A !@ɐ ۚถ Ȑ  @  #ې`@ǒ  )@! '%ۚ  @ @NB   /#\-+ے@hax @  @N%,7װ TD&8@N(2 㿠`9 @- X )'%" #!@3 '`!#\ `@ @ `! @KȘ۔!Ȁ؞ #\@ a @ښ @6&@LВ 1ې!@X ;97@D"5ۚ  @2 a@Kߐ 㿠 ;#\9/b4"HX! @  ֳ-ۨh@/  -eے@bۚ"x !@ ;ېb@ "#%L5ے@ۚԒĐ !@ #ڒa@K ۀ #\@ $c4!@e `'ېD@ 97!1ے@Ґ#tT#d !!@ "@Kn 0 ,&0&,,@)ے #  ŀ@,I  (<(@ `2    &05ڒ@K: `/ ב !ܐ @ 3ܐ`H1@o7ܚ (8 !Q@ ]@, @+``ܖ #\ ܘ  |`!a@Ӛ / ?" @.܀ #\@  `Ė!k@`< (-/ ܀ #\@ Ԙ !v@  @+ X" < "  ( 9`;ܐa@ -)%I+ܒ@a4!$ !@ /$9ܐ!`@  3ܒ@ܚpa !@ Ҙ #\ ܒĔa`! !@ @N`@5%٦"%#֦)$ ! 'ܰ  !%@J #\b!@+ !@JM@K#  㿠`= @+ X%#!" " `@1¨ '`,bD#\"T!`@ @ @4&`! @IԘܖ #\ ܸd"l@ |!@ @J 5ܐ@i  ;@Wb97ܚ"⬐ !@ D  㿠@J@K  @* -#\+)ܐ@ ؔb"!@ Ð$```$@͐`Š $`5ܒ5@IƐsa`` @@*㿠#\ 1/ܔ#,<!뀧;ܐG c)@  %&  4&D&H&L&P&T@I&<&4&@&T@I@K   #\!ܔtc#L!@] @Kf,װ   @&8@Kg2 㿠@J|@J @*] 25@\T5@IY`` @@*C㿠9/զ& "<&D&H&L&P&T@ID&<&@ &4&T@I4@K$   +#\)'ܒc#̘ܖ"@ @K,%װ   @:&8@K2 㿠9/k& "<&D&H&L&P&T@I &<&@ &4&T@H@J   +#\)'ݒc $"'@Ú @J̐,%װ   @Ɩ&8@J͐2 㿠@I@I @) 25&`5@HÐ4p^`` @@)㿠#\ 1/-ݒ Dh`x"BD @ @ ͐ +& `@ ݐ` @ ݚ ਐ "I@ ݘ&D&H&L&P&T@Hۚ ܖ &H&4 &<&@@Hz@Jj   '#\%#ݒԔa "O@D@JM,7װ   @2&8@JN2 㿠\@Ia@Im3ݒa@'(ݒ @!" @) X" ҧ$% `$@)0@)*@!%$'ܲ @H   @Д -%@H 97ݒ!@H$׵ף`` @@(㿠#\ 7/ݔHX";ݐG a4)@ǚ #\'%!hᄘ"@ @$`$a@G&$@H &D&H&L&P&T@Gΐ &< "&4&@&P@I   #\ݒᤔa̘aܖ"@@Iװ @&8@I2  㿠; a  @D& @(@(} 㿠` @H" @H&@D @*J@(f 㿠/ݢ #\/-݀@D` "+@9 )'#\b,@ "<L"%@-!#\|@ \"l"@"#\ݔ"⬐@ b"@ @( 8@D9%  #\ؘ" "@ @^`,@D %%\%,%  %@' % ### 517%3`D%  @'ؒ X@1)$!  @F%,"#\c#<@ @š @G `@㿠 @@)@'ʁ `@㿠 +@'   %)'\%% %%(@'х@*#\`l ఐ?㿘'H'L'P'T'X@ȔH㿠9ж"?@ 5^3^`@@ Đ@@ 4 㿠;^'`;^` ``&`@&@&㿠@% @' '`@&'`7^'`&㿠@@㿠;^`  @&@& ;^'`㿠N `( N N "  N ` " N  N N " N ` " N " N N ` N N N = N ,N   N `&N "  N " N `  N `N " N " N " N =n?N   N ` "  N " N  N N ` " N " N " N `0#N 9@|N N 0N `9 N N 0 N `9$ cH @ΒN N "  N " N  N `N " N " N " N ` N ,`!ݐ#@N `N , N  N ,2  +ݒc@|W " $ O 0 O 9@|#@$T @|5.@@%cN `ܺ 8#\"#\\` +/-ݤccȪ d@@\'8 & @@{Ɛ@{Ð  d@c@{@{   d@ج !`@{@{  ݒd@ה#@{@{ ݒ d@ɔ䀦 @{@{ `d@ @ 6 . .@{m@{j d@  `@\@ @6  @{_  @  /x'@@{S +@%``"xV@ @2 2 'x" (!(-&@'|@{h  @{_ #ݴ #\ch`t" @ @3`&㿠@{  @{>  㿠;a`;ap 㿘@z;@zِ``   $@'`@{ @@:   ` ޔ #\"B  @ @``  ` ` ^?` -+ހ #\`?༒`"O@'H'L'P'T'X;^@H``1^-^ %)!p Ȁ 7^5^ȟ@9!p 'H'L'P'T'X;^@H`䀧`1^-^ %)a!p ̀ 7^5^̟@9!p\ 'H'L'P'T'X;^@hH`耧`/^+^ %`'7pĀ 5^3^`ğ 9!p71 @z.p@zb@z Xhx㿠:\/8`-`ޚ ޚ`ޚ!ޚ!#ޚa '%ޚ8P)ހ!h ޴a`޸a#\޺a3ސaȒ ^^#`^ ^#`# ! Ё'P'T'X;^@P`Ԁ` 9^ 7^Ԑƀ^#`^#`؁^^`"  "`> `#` d ``f`g-` ( g$  f  `e   d" `e  g  f  e#` ``J *: +  `"K`:K`` `K`K`2`K`  +``"`  ( )՞㿘  N`& >< !0(*@ $<` m >xM=f; 7s5 @ K )  & Ő @!< @"R ' ' @!.   ' ?'   @!  @"' m@"%  Mf" s"  '  ' ' '  c @ ߐ <   >" ' @x'    @!ݐ 㿠<?  M^ &" <" >"  "  |" ~"   `& א@! @   @!@! '`'`'`㿠'DDH (  8X h0@P|(`dx|LXhpX㿈^' ?#`  ;@wa' ?'@!h'!ް!#\O `  3: #d# b`    $@"#&`&`&`&`H% ' N ' x-%$ Qa+ @5@w|&```!@wh&`` `c`&`&`H'ǘ%$/&`n&`k&`h&`/'@wm\'@r <&`Z`@wd <-`@wadO`.;K@ &`FӔO&`@wF'@v@I &`1@vޒ `bt@''@ &`"# K`"d`**`€ &` &` &`  &`  &` &`'@v$??􀥠?􀦣@v$??`?@  &` &` [1 ]b&`` Β g?2&` d&` e&` f&`< &`&`@v&` ` ` `/& ?&` &`@ &`d&`@v]&`&` ` ` /t&`q &`m &`i &`b &`^ &`Z &`V&`S&`@ؐ&`Lސ"n&`@Y &`A`+`+`;M 2&``1'H N  `'J` K 2'K`%M `'H`%I 2J`*`&`@&`* ``  &``&#`K` . $,/  -,@@&@ $$??` )U#l?#&?&?' ?'`?$$?$?@\b,@\?㿠;^``쀧`&@@` Lt         Xh0 㿠`Z``V ```1!%` B. ƀ                        5`- T- @`O    ` @/ ` ` @%` @!  ` @` `? `@    `   #^` a$ @'^ &`3޺ Tcԁ~؝#t7^ #`#h #p#d#l`'`쀤 `9 @`l@ ` `h `t ` p ``@ `Ђ@#xЂ@@Ֆ `/{߂l+߸`#@`#| # #   `<``` ` `s `" m```"5`d߀` `  `"]`"V` "P` ` "G߀``` ``8`2 `F`"= )߀`f `F`d`eߞ"`f( `*߂@{ egfq H/n/@` d@6   #d〤/(4 (c4 c$, @s,Ҁ/߂є`@`@ Ē dȀ/ߔx @  d/߂Ӕ@`@  d/߂ؔ@`@  d/ ߂@ ` @  d/߂Ҕ`@`@  d/ߐ`@  d/@s1ߖ @  d/@sߖ@ v dz/@s/ߖ༐@ m dq/ߐ  d@ eli/t 2ct|a/ߐ`ؒ d@ UhY/p `2SpQ/ L/@s1 /@s, / @s( \"<@s" \ 6/4//60   ,` ,``(/  /   ,``//6 H " H /,``6  H /ya/  #\/ ߐ 1ߒ$H!<( l@@r&`4   "@rʔ @r    @r"@@r (  ` ` ` `  [/`M  & `! I ` 2&`% M M``"`K KM  ` @ /M%  ,``"M  M%` "/,` ,``/ `} ,``/w `r@r@ ,@F`߂Tbd` d/`&@/`@r#,`^#`^#`^ ܚ@#  ܀ߐX7obJ ` *J J  ( 3`@* 2  *  㿠;^a  /^% #!  a#\%!  [`?r ^^ #` * `" ` `@qd`` 㿠;^a ;^a  a $@F &@^@:+ $@5 & , %  "#  ^#\ߔ @#` `?b$  ^.@%#@  ڸ @" _& %^&  -@& & $㿠b ;ߐb0Y` @ " ` 㿠P;ߐbXH ` @ѐ " } ^ #a㿠7^` +^a a    "  @ `;^@ø $$'a㿠N``_ N`\ `N`*<`:N`  N``?`O`*N "D ` O`N  ֒ L`   N `"+ Ò2% N  ` N " N`?N`? `" N N`2   N``` N `?㿠;ߒb@p: N``<# `@pR9N`" N`0N` 9|`N``wN`0sN`9$`mN`>$;?`c@p,"s9N`^ N``0ZN`9V`N`QN` 0MN` 9$`G@p S9N``N`0N`9`N`  N``0N`9$`N` .%N``.!`@o",9N`N`0N` 9`N`` N`0N`9$`N`7ߐ  @8  8  " 㿘@o >`㿠 @A:@ F`&`& 7T တ@oҒT a @o͒  F@oƖ  `. ('T`E @o ;T`?a@ @o T`  F`dC@o  ' . &;`b !?q@o*`b&  / @ !O. ᐞ&@&@o@B? ` bb @on*`#@ +  b* &@od ;za\@@<`8`%,%.`+@ :` @) @2 zaZ@=:&@, $,+`  am am?`4'zZ@@< :`#@* #* ) @ >``@-@2 z\@ @; <`" *`" ) @/`@ !m !m= &f/  `& 2`6 < @n ` ..@n @n < `. .@nܒ. `.#\  ߐ ߔ#8Dc [ *z\@8`< %.`%-`@," 9   *`1z![@=; &@,`%,@+     < &:  *3zaZ@@:`= $+ $@ + *@ " =. %z\@;< # * "* )    `.=f .5h L#\#d#`@ d@P`2/_ /1""" -$h%z^@ :>"@^@^ @8>= @$X@@8`< #@) . "*`'@-(;ߔch @&@ / $h#1z !X@"8=`%Z@X@ @<`: > #&[@>`;+ ",#@ *%@- ߢ" ,`ct#@ 1$I* ^\@@#d@1^=`,!0#\%-߀^ @#`$@9 #h9 #l |/`, &. @@ d@ |㿀`  +c@ /V'/　@ M z^ @; > " ("@) (`:  ,` z!_@8? '@.`&-@-` ' '*` *.`" ( @/`- @(%@-@,@' *}'@mH'%?ย /-1  9 & 2&    @ &2&㿀/ߐ6  #\     cߖc !z   `;" -+` ! ##`!    `<. .  `; ;" 9 ,`H ސ  4@!˘   # <. `.   ; `" ;`h;`͒; p`|!   %`. .  ) "  ` 7 ฐ !   " . &     *7z _@@=?`',%- +@ "  8 ) -z Z@@? :`%+`$ ,@+ @      @  Z ` E  !2   #.  .  T)! : +9 /%a<!(4 !   .  `&   .  */z Y@<9 #*`#@ + @ *"  ? `-%z _@@;`?`" ) "@*(@     @. <-\ ! 79#\   `  ː!xd!p !   %' + *`,''=`+ "  *`" @=@ @?`7`?/`@?` 3`+`e, 0(B`(` 5 -`, @7`/`E +`@2c + *@ @7퍒 za !g q !u #\a [ܔ!ښ! H   w s o k @g cE~ 䀥 -@3  !\7bHT "  ! b   ""̐ "   ; @ G " n !ງnG !" '%#c "֘ &`&`6 .   1 - @ )    %,`%,@+;`@ G    "@ ) "(8@G  ) #;`@ G #7  " (` @* @(@-&-`=@G7 쀤  &-`%- %,,` ;@G 7 뀠 $@, +`#* *`: @G7'﬐ 7d d(#`!#(L d 8h #\ ` \\ #\@iؖO \+@i͖ @%\8\)  0 X x2 0    + @   - ` .  `` &``.``'@``` \\ "#\*\\##\+`@\ `$$%'@@@\M@. @. 2 0.&`" @  ". 0. $\L.M.`@&@̀`㾠'L`'P\LP & x % x/   -.  +.( .  0.) #.#X@iV;`@h`  L,Oc,,;hh@iCl@hՐ* >  `/`? & @h@h㿠'P'T'X@P㿠`` @@?&` @& & `@&`dddd,d,dddddddddddddddd dddddddddd P,,,dPdddd ddhddd #`$  @h)@#l;%/a,#|#p#t %`#x* #\pc`c !{  $ N "-?` %@"  `6, ``  #\`  )%cܘ#!}֚ M % $`N,  #H`% x,  $`#  ?N`-H`+H`  H` #H` 00H`-  "#"+"  `" 0"```H`-H``+H` H``#H`02 H`0%H` 9!H` $ H``0 H`9,H`H`,`! 0H``0H`9, H``*  `H`.1H``0%H` 9!H` $ H``0 H`9/`H`H`,`! 0H``0H`9/` H``*   `H`l Lh" q"@`H`l2 `@````H``+"#a%@8(@Xo   %@䀦8ʅ. @  7 #8#HX#@  "F#   `   8``  8``#ܦ`#ܔ  #\#`#d#h` H4`#\쉚` #\`dp`{ # $ `ƒ ` ` Ȣ #\$@4`   `$Z܁?`6, `  B;$@ %#\4`/ `,;47`##a#  #"N   #  #\#`#d#h7` H#\4`  `  #\!(8 # $ `J  `"@Ȣ##\$@ 4`DPa`$ޚ?`6, `    /$@ -#\4`+ ȔԘ`뿚 7!##a@  "` # #  #p   ##p  ##pxt  #\#`#d#h` H4`#\ ` #\a̘aܖq # $` ` `"Ţ #\$@ 4` !"`$Pp?`6, ` |  8-$@ ;#\4`+ laxa1*7b#D#bT#Ćd@  "p#   #Ԁ    #  #Ԕ  #\#`#d#h`I4`#\`  #\p"|⌖ $ $`0  `"@Ǣ##\$@ 4`☔b$Ěԁ?`6, ``  ;$@ %#\4`+ bb(8꥚)7 "####@  "#   #؀    #  #ؔ  #\#`#d#h` H#\4` h` #\c ,c<Z # $` ` `!Ȣ"#\$@4`#TdcH $9؁?`6, `e "%$@/#\4`'ؘ̔`@           ,$`=,       #`#\  cpc㜖"K#\4`7㨔Ȗ"ך` #\ #Ԕ#"ɚ # $` ` `""`$#\$@4`7"騚?`6, `  5;`$`H`8"鎚#\   T`l |"通NK`#\'`"q $@#\4` Ж"a$$  d$ @  "?` $@&$@#\4`'`ܘ`"?$`6, ` l $@c=  $@cQ @c2$@ #\4`! "à    |@c @ @co2"@'@@@  # @ `` $+ " ?` $`$@b  0@b֔  0@b͔@bޔ $@4`#\;%a4a@P#蟚    $% #̘!#Ж  #%#  `#`#`#` # @b#\   #\;#`[;`Q4`Ȗ`̚ж#\];`  #\!̖N; ' $ `;  `#¢#`#\$@ 4`ؔa );$#\?`6, ``S  %$@ /#\4`-\hx `l `,  *( #\""  #.  ``  $2 ?` $@#`6, `' , 㿠'D'HDH 㿠'L'P'T'X@L㿘; #\b|;7‧G b☖#I/礚 -+#\⤐@ b#J癚'&  k㿠'L'P'T'X@L㿘; #\b;7‧G bؘ#b/u -+#\@ c#cj' & <?)!#㿠@  @$ & 㿠 9#\;7†cH@ #T` p ? 3/#\-cl | q4 @@ 㿠 #\9;7†c@ #㬖 { ! & & & & & & 6 㿠 9#\;7†c@ #ĘЖ      `   @a  @ u㿠Ȑ&  & & 㿠      %@a  %@'  ``  @ ` &`㿠 #\9;7†cܐ@ # 滚 & & 㿘 9#\;7〠`@   橚 @ @`㿠 9#\;7〠`$@  0< ܺ 挚  &    #\ /H \h y `  6 ^d *  &  @&     & &   @V-^d  5<   `4 2K   .5`- @,`2-@ @ @ "+   @ "# & 6 &      @`B#   & $@ &   @  &` @&  㿠'H'L'P'T'X@H㿠` ``@_,  `2㿠 #\9;7〠`@  ਖ!H Ț #\-+ ) `Ԙ !I@`?庚   $㿠 #\9;7〠`@  !R 妚 #\-+ ) a0!<!S @!`?喚 #\ !Hh at!T`?剚   " 㿠  '@/@ & 㿠  '@/2 && 㿠 9#\;7〠a@ " !o Y #\-+ ) b8"D!p@`?K   p   㿠;bP㿠x;b㿠;b݁㿠'H'L'P'T'X!H;͐b^ b (@ #  K`-"`K` +`K`  K`` K`0&  K`94 K``  㿠^a`(H5&65+ @ &((J` - & $ "3(L`+23&(M (`&(O``-(O   &(&?(`&(J`& :l @^fO `:U O :" (H` `(&u"$& &@^& 1#` &`*@ &[  &@^r& 1&1  &(&! &(N`: :` ' %p@^6L& ?(&&N`2-  `& -?(K`  &` N:) !p'@^ 4& ?`&(?&(?+ "* J`K` J`K`@`J`` K` K`J` "`J`2  K`      㿠" ?    "2  `"??lXp|؝0#%#`'cp\x#d!3#h -#\z d##\!4/ n#\#̐!5 c?`^a`'`@'?``-@` `?  #t` #p&  #l  #x c.@L`- L +2 `$ " d[L `5+`@ ش ` O'`؀L`- Ѐh ɀd6#\䀠@ `!L L =L`  ` '`L,,6 ?" '`?'`p'`p?l ``+@  O| #\䀠@  ,8!⬚L` L`=eL,, ZdǖL  L= #\ #\4 D\`h!y#\t``!nL =,   `'` %    O'`L 2,  ``x `'`(@'`  `  | Ot'`󀦠'`  `o O'`瀦L! e O'`݀```'`'`, `@\4'` ``` `'` `` '` ``"` `"` `'` '`/` 91`!p!@@[`" ?`#  ??H O'`㿠@#\㿠 4#\  " " " " " " " 㿠 @H (@㿠 9#\;7䀠al@ !x጖ ጚ @+@ & 㿐 9#\;7䀠a@ !἖!s @ @@ؒ @Y& 㿠 9#\;7䀠a̐@ !ؘ! R 2    @㿠 9#\;/䀠a@ "!-9 ؐ  y& & & xܺ $`&؀`&`&`&h0Pt(㿐۔9` #8.`@@7 /`/ @dD@c(2* a.(6F@B@ ,5 - @d@d+ 2*  @  @ZҖ#/`(0@e+`4 , @c + 1 )  @@6/ .@ E#А b@@Z 0(`(@c B `/`6`.` F @Z <  @Z. %T@Z  'N@Zy  ) !@Zp  + b@Zg  -xb!@Z^  /xa>@ZU  1xb"@ZL  5?ߦ,?L|LTC0AAeA.@@@N@ @A"uABACwIA~A~SA~P㿐95"ذ` S.`@@***ʅʱʩ23"#89 ^\ Z@="* **ʡʩʁ,-01 ؉45^\ZP#"*** ʁʥʱ:; ! ̉23P\T@ "***ʡʥʙ"#01 ک23 ^\V"***(ʝʡʅ45./ڥ01 ^\Lׁ"***0ʙʝʩ23,- ڡ./ ^\B "***8ʅʙʥ01"#ڝ,- ^\T"***@ʩʅʡ./45 ڙ"# ^\R "***Hʥʽʝ,-23څ>? T\Po"***Pʡʩʙ"#01 ڽ45 R\N U"***Xʝʥʅ>?./ڹ23 PTL;"***`ʙʡʽ<=,-ک01 NRB !"***hʅʝʹ45"# ڥ./ LP^"/Xp"#㿐@ `& & &`㿠 9#\;7䀠"@ b⤖"'-ރ +)䀠 #\@ b"Ԗ"(w ``@ 99``@ ` +9䀦 Q```& e@& `&& `b` c & b`& ` & " `;``ڨbc "0㖘 `B`@݆#P  & & & 㿠 9#\;7䀠c@ #㤖"S- +)䀠 #\@ c#Ԗ"T ;`b` & B & `&   3 b  `& D & && 㿘@X8  " >& & .&@--`&  ;*c䀦  & & &   " #" "  㿠; स"  @X27  @ * 7  !* 7  *   *  *   *  A* * ,, , , @W㿠`  V@@ 9`  @W2 ` `@ 7`7` @WQ/ 7` /   !/  /  / / / /  ,, , , 㿠w7   A ?!???* ++ @  @)?!h???,`.(@19ܴ ܲ D? ? `?+?+`+    @%ܚ+&F@b**( @ h܇!/?  /? /?/?/' ...@W526 `"  ` * 6  * 6  !*  *  * * * * -  -  - - 㿠R7A????*`* ) @@?!h???--`,@ 79*!P(t?&F@?b??/`-,   +`+ *`  / .?   h.?.? F.?.& ---@VO@V㿠  @V2 @V|㿠9@  v`@VW.㿠j;b ʒ㿠;bT۾㿠 ֔;b۱]㿠;۞b;ۗb㿠 `;cۇ ?  8  㿠;cH0 ;cd75P\  '  @U؁  @U" `x"  "  " !0" 8a\"  " " " " $|<`$h9;#\-倠@ #c VO ȐȒ @Uc 8ɐ'  + aȲ  ,  #' ,׾ '`$%#שc  e  ) #'@צ 7`/-ב  k   `$' ׎ `{`@  ,8  qh   ``' v `c |ht  wP   ' ^ )` '%I ਖ  }8  + `' F `7/1`    ~  ' . ta8` !$!0   e  X' $ [t`!`al   L # a' ( B+` )'a!ᬐ  ֘ 4 - '  *`7Аa  ߾   '  ' 0  '  ' 4  #\bb(  -    쀤 Ȓ 㿠'H'L'P'T'Xx DH  㿠 `@t㿠 5#\/- 0Xd@  + bl p #!`\b‒"t  J `%`$X 3)`;Cbb"  2 㿠 1 0&    '` '  & &`  %  %( 㿠 & 㿠; #\b;9怦Fb"! 3ً #\/- 8b$0!!`? 8㿠;9#\c8;怠cH@ #T!'o  ƀ㿠9 #\#\9/性@G`#lx!0+\ )#\'c 8#㸖!1%`?O#!#\@ c̘#ؖ!2D  #\@ 9c#!45 #\  0 < !5@ & ` 㿠; #\`D;7瀧G `T`!=- #\+) 8h` !>`?   #\瀠@ ` !@#\ Ȕ`a`!A@  €㿠; #\a ;7瀧G a(!H֚ #\/- 8+0\ah!I`?ɚ  #\ 瀠@ !p|!!Kع#\! !a!L?@ ت㿠9 #\!9/瀧@G`!!U+ؙ #\)' 8a"$0!V`?؍   #\瀠@ 8"DP!X}#\ "┒bX !Y@ ov㿠; #\b;7瀧G b⸖!b-Z #\+) 8b"!c`?N  #\ 瀠@ c #!e>#\  cPc\`!f@ 07 㿠; #\cd;9瀦Fct#!n/ #\-+ 8㈔c!o`?  #\ 瀠@ #ȔԘ#!q#\! #`$!r@ 㿠9 #\ ,9/耧@G` <H!|+ܚ #\)' 8`P |!}%@ Ϛ#!#\@ ` !~Ě #\  ఔ``!  @ ׵ `㿠; #\`;7耧G a!-ע #\+) 8aD!P! @ ו#\! !Xመa!@ ׇ  㿠; #\a;7耧G aḖ!-t #\+) 8a!!'@ g%##\@  b! [#\ " P"\! @ M 8a㿠; #\bd;9耦Fbt"!/; #\-+ 8∔b! @ .#\#! bȔ"!@   8n㿠; #\c ;7耧G c(! #\/- 8+0\ch!@  #\# !cp#㬖!?@ @㿠; #\c;9耦FcĘ#Ж!/ #\-3 8cؖ! @ Ӛ#\%# !`H T !@ Ś 8㿠; #\`\/;逤@D`x`l!+ֳ #\)' 8` ถ!%@ ֦!#\@  ̘ؖ!֛#\ 쀠@ `!֏ #\  0<`!!@ ր `@㿠9 #\!D9/逧@G`!T`!+m #\)' 8ah!᠖!Ȁ%@ `#!#\@ a!!U #\  Ȕa` !ʀ "@ F ` 㿠; #\b ;7逤@bD`(!3 #\-+ 8)0b\"h!Ԑ@ &'%#\!造@ p|"!#\造@ ␔bb! #\  ! "@  8<㿠9 #\"95逧@#G`! #\-+ 8)cD#P!@ '%#\#造@ Xdcp!Ԛ #\  #x #!〠 @ Ś 8H㿠 #\9/3逧@#G`ؔc̖!+ձ #\)' 8c !퀠%@ դ#!#\ @ `, 8!?՘ #\  @`p` !  |@ Չ 㿠; #\`;7ꀧG `ࠖ!x #\/- 8+ਔԘ`!@ k)'#\%ꀠ@  !_ #\ !8D a!@ P 8㿠; #\aL;9ꀦFa\!h!5> /-#\p@ |" 2#\%# !a! $"@ $ $@㿠;9#\a;ꀠa@ !"  #\/ -+((b4"@    (㿠; #\b<;9ꀦFbL"X"   #\!ꀠ@ lbx"`"#\)' %"ⴘ,"@ Ԛ ,@㿠; #\b;9ꀦFbؘ""š   #\!ꀠ@ c""Բ#\)' %# HTD"@ Ԥ D@㿠; #\c\;9ꀦFcl#x"&Ԓ   #\!ꀠ@ ㌘c#")Ԃ#\)' %#ܘD"+@ t D@!㿠; #\c;9뀦F` "25] /-#\@  ,"3 Q#\%# !4`` l 4"4@ C 4@㿠; #\`t;9뀦F` ":50 /-#\@ घ"; $#\%# !`  8"<@  8@㿠;9#\`;뀠a @ !"C  #\- +) a\0!h"E@   0Ā㿠;9#\ap;뀠a@ !"L  #\- +)a0!ܖ"N@ ֚  0Ā㿠; #\a;9뀦Fa""U/ӿ #\-+ 84b@"V)`?Ӳ'%#\"H@ T`"W Ӧ#\ "⠒bh L"X@ Ә L@㿠; #\b;9뀦Fb"Ė"`/Ӆ #\-+ 8̔c"a `?x#\#! c #8DL"b@ j #\ L# 0㔀 "d@ [H#\c@ c"fK}㿠; #\c;9뀦Fc̘#ؖ"n/: #\-+ 8 `"o`?.  95#\/쀠@  ,8"r#\!  @l`xL"s;쀠@  #\ `,"t  @ #\@ `Ȕ`Ԗ"v#㿠; #\`;9쀦F`!"|5 /-#\ @ $"} Ԛ#\%# !,aX!d P"~@ ƚ P@㿠; #\al;9쀦Fa|!" ҳ #\+) 'a!P" @ Ҥ#\ Дb b`0"@ Җ#\  @ b,"8"҆㿠; #\b@;9쀦FbP"\"v   #\bd쀠p@ b|"f#\)' %"ⰘP" @ W#\ "b ,"@ IH #\ @ #$"9J㿠;9#\c,;쀠c<@ #H"*  #\/ -+P<c"@    <㿠; #\c;9쀦Fc#"5 /-#\@ ̘ؖ" #\%# !`  @"@  @@㿠; #\`(;9퀦F`8 D"5ۚ /-#\L@ Xd" Ϛ#\%# !l`  T"@  T@㿠; #\`;7퀧G `̖"/Ѯ -+#\Ԑ@ `" Ѣ#\#! `!$0X"@ є `X㿠; #\a8;9퀦FaH!T"5с /-#\\@ ht"Ī u#\%# !|a! L"ŀ@ g L@㿠 &    %\%  $ $%+aْ31/Ő!-Ȗؐ %ֳbǒ ;͵b@97"$4 &֢ 㿠` `& `& & @Kg 0   &  `   \ & <& @㿠 `` ?B   t㿠 `  `( `( `, ( - bdn#!`Zb‒"p 8H ``$%X"-`+)C̚b" 82 /C 91# 53c 8  ` 㿠   ?֒``  @ "``"`" " "`#`"  "``"`" " "`#`" 㿠 `Ԓ`'``&'`&` 㿠 `ɒ`'``&'`&` 㿠`     ց97#\5#@DT    㿠 ` k " "  ` <`!#`̉ "? '%#slc|   a )#k "! /-+Uc   C  @& @      㿠/@\`Z '2  @(  `4L < #\@ Ϟ`W'`5/X``p  #\@ ϊ%  " `| #\$@ s`,'`;97` ฬ  #\@ _&/ 1Βc#  Լ  㿠 &       n!@21   ˣ " ;7`5ˍЖ  |    㿠 ` W " "  ` <`!!u "> '%0#_a$ !  M )!PX "! /-x+B\al !  0  @& @      㿠  `\`<"` 0 `!  !a!   $@"! !!!ޘ ' -ݐ<+)b "0!ʘ `<@`@`'`@ @㿠 `  `\( <"# 1  pʱʞb b|"!Ӌ $@ʙ#ʅ"b̐!r %ʃ +qc)'" !^  < @ `' @ 㿠 `  `\ <" 2  LF`3ct cX#h!  ``$@-#`#c! #c -+)cؖ#!  <F @ $ @ 㿠  ``\P`<"K`2 `(ْ Ɛ`P `4 D!ҳ   $@h# ɬ t`!ҙ ! ɪ +ɘ`)' Đ!҅ `<@̔`@``'`@ @ ` <"@  ``"   ``   ` <@  #      `   ` `㿠;#\9a;a @ !!P̓ `㿠;#\9a(;a0@ !@!X̃ `㿠    #\#!aL!\l!d`?l & &  #\3/-axሀ@ !jZ &  &㿠    #\#!a!Ā!w`?? & &  #\3/-aД@ !}- &  &㿠; #\a;9Fb"!5 /-#\ @ (8!  @ @2 #\'%`#DTbd!@  #\`"␀bp@ !  #\`b`✖!-+1`?њ#\̔b`"! `?Ś``$``$`㿠    `'  Ā'8 -$+$)c# !  <&@m &`@'`&@㿠 `L    < &#\ 8cX! #h@ i ct %#ݐ㐒c !˘ $) @#ؒ 9/-Ð#ܚА !в  ` ! "` # #`㿠 <@ `   <   \\&@ ϔ    `  $ƀ㿠 0`    $ M .c_ L !9  $`4H"% #!3\`@ P!" 't3 -!+)` !   "   <&@㾈 #\b  `д    `?"o   `#`` `#d $   @ `` ``"W#`#`$  <$@   < $%#\+- a0@" @ 0 /LƸ  ƥt !Xh "ϒ $ @Ɵ  ƌaᘖ! "y`$ `"='`#p)-"#l+b#h d e c  `? <%   < $#\ ̔a! "9@  H  5b0"$ "9" $ bH/  p "Td "9 ` "  $   2$%@ #\l hpn@`d-$``2 `d  ` tr`e `c ` <$   < $@#\ 3b̘b܀"K@ 0 bŸ  ť # "KΒ$ c(ş P ŋ7#D4 "Ky` ` &`$ ` 2$ %` "`  @`  `$`'```  C:@B섞J `  * I 2 I    `*  `#       *+` (`  + 3  1  (`0` 2 *2 3` @㿠 #\7 /-h`X M %#@ ^ #\! cԘ# N T@ R @   #\ c   R@   @ H X#\`, Y& g㿠 #\7 5/d`X a '%@   #\# И` b`T@  0 㿠 #\7 /-`X$ m %#@  #\!0 aX!h n T@ ؚ ^㿠 #\7 5/t`Xᬖ { '%@ Ǻ #\# a |`T@ Ǯ ݒ 㿠 #\7 5/$`X4  '%@ Ǒ #\#@ hbx `T@ Dž @ 㿐9;1/#- `8 #\ #`#d #h J 㿀195;% #d8 #l` #\  #`  #h #p#t#x+ 㿘 #\975# #`   㿈9;- #da #\   #` #h #l#p 㿠'HH㿠'HH㿠'HH㿠'H7H㿠'HYH  € " " `" "`㿠 @` u  ٖ '  㿠 @  2" " " 㿠 J   '`㿠`  ɒ `  㿠 ``'`  `'` 㿠9@@̐ 4 N 43` b  'Βb !˻`3 /-H ƒ³c( c#!ˠ#@&±x#Xch!ˊא '` '` 㿠;^ 'b7;^'bL & &/^+@@ @@` & . & / &`c&`%u  )c#'%㬶 !P㿠;^b` 15L` 9' L/#@@P!5㿠;`H`H`  &㿠;`<`<`  &㿠 `X@@" @  /㿠;^b`%)3`@/^+1 h鉬 `8% 9 h75HX ". ρ' (@?ޔ"㿐;`ؒ Œ  ":ʲ ( /&! T`@?Đ `. ```@@.  '`Ժ`' @? `В @?";!` ? `  @   `? `   4  㿠Иb@@ x '?@&&@ ;b@`&'&!( @?M"c㿠豐  i`m^" o%)沦"+a5 ;a/!-ᴖĐ " 沐" '⃀^@@; >`#("*`" ) (`&@$`+$` `H `H-Ho `  `d`5$`&` ;9` ېb@" b0" Ɂ 8!H@>ؔ"y`Xl@>є"z^|a@>ʔ"{)沝㿠;b\Ē ;b9"lb| " ɞ㿠;`H;^b 8H1` `   ##b )'%`{# "j &  b"@>o"`;^b`U < /;@>]/@>e @>^ X)@>] h. #b$% h@$''@>DȒ@>O  @>E < $9#7(5㬖 " H' cx"#Xh   c #8@>" `;^b`q9 X /W@= @> @= '%'. @=Ȓ@=X@=h. #h@ #?h "? @=`'d֒  -Đ+)`t  #ȱ@=@=Ւ/ $9!53` #Ț`    <",  Ȅ5#@=" 㿠 ;^bb%'  ' )' ' @<  @ ' @<  @<  D75 DJ % %ݓ*`% < . # <;a\   `  $ 3a' ; 9!5'1! #^ #a0@=##(;a@aL@=#E㿠;^b`=!'<47+`' `  @㿠  `  5#\3/H``l!+     *  $  `㿠 #\9 75 t"`  #\+) '` ̖" `? `ߒ& 6 " , , `  ( 㿠  @   @5㿠 #\9 75 Ԕ쀠`?"I  㿠 #\9 75!$`?"O 㿠;a,   !H4@"T ` ah ސ!p|"X ˁ #\`#!a !Ԗ"\`?D a̒ 5/-"^ `6`㿠````㿠 #\9 75"0DP"p`   #\+) 'bX"|∖"q `? & 6  `2  ?c 2   ` @ 㿠 7#\/- ␔⨘"` ' %Ԛ # #\@ Иbܖ"ɚ ` /`  `Ē`` ```&`$6`  㿠` -R`1L#<` %````㿠j  @4 & 1&& !&&&&&&  ƀ㿠  `  )#\'%#㸘Ė O   `     #\3/-cД 4  @& 㿠  `  )#\'% (    `     #\3/-`4Xd   @& 㿠  `  9#\75 p    `㿠  `  7#\/1ഔ  К ' ' 3&a   ŀ㿠  `  9#\75 Иܖ   &` &`㿠 F@3Ô ā㿠  `  9#\53 a    &  ŀ+'`́㿠  `  9#\75! ,!y  㿠  `  9#\75!8HT! e  `   㿠7 8 5-%`a  &8&@& @3w@&&#&#\ `?     & @`       #'a&1  ?&`   㿠1  `   yw   @I F  @   %%#\+#@ aaЖ & &8&@& @2ה" @a %@#\`?~ @ "8H #\b,@  i  '     @   )'#̐&@  '?`  @``" @` @ `` @  ` #  @ 'cl㿠;`&` &`+'"` c̐ ")'W  !R㿠7  && &`''%'Ւ#ђ`$ P   #`& #\!B p2`"X   `P`)  T@1 F㿠9 7 T( T@@1   H'@$ L'@%^ P'@ '@#^'@A& b=&`㿠ۢ ۟ & ۜ  & '` '`  & &  &`  % %` %  & 㿠@o ۦ ۣۡ㿠v " " " "  `  "  !    #  "   `     `   㿠0 " "  & #`  "  " "   `%  "  $` "   `'  "  % "  & `   #`  &    #` #  #`   `  #` " #`  " `#`   #`  @ ` "`#`"`""` 㿠   `  "   &`  % ' ں   @  @ ``"```! `# #`#`#`   "  ` @     *  "   @   @ *!x@ޞ `  "  !    # ^ `   "`    @    "" " "  *b @ `"  `"      #``   "   2     #``  "   2        @      "   `     ``@ `  `         ` "          㿠'H  `H ŀ  @2%  @   # #    `)  `  `? ` c`; `((0@ +@ ( ``@:  ``  8`    ` ܆ 㿠 `    '@ @ؖ %`   `    #@ "   㿠 `   @f`    ``   `#` `    "` '` '`'`'` '`   @f'`  '`  "`  " ``$  #\ ` ` ␔b̖"   '`  $`  `   %`# #\   ؔb#" ` ?< `?;`#    ``@ @%%  ` ?`:` ?@ :      %> ? ` >`.`?& `?be <b, 0@ *(@@ ) @@$@$㿠V #\`!c(# "Ր@  `# '``B` #\  3 /-c4dp"   ``$` $`   ## #\  `    #|㬘"  `  '`  &`  ` ` %$㿠 ``   @e    ``  "`   `' %: "$ +)&c'#Жܐ "  " `" "  `"    & " 㿠;` `4  ( # ` E#\   / -+Ht`#^   &` `$   `# "``"#    "#  `""l| @$ < \4㿈!& #\    @) -  #{   t##`)+ #p`#l`#d#h&@#tpu d b`hlQ  "`$  2E  \  $B9 $\5 -! ⸐ Fa0X2a$#\P  `  $ ` *`@`<`\1P *! `   `?@a ```8)  `* a 2 ;  @ ? ( * @ 2$   $  $ђ $ʒ@<`\1P *@! @   ?@a `b`:)@*a 2 ; @ ? ** @ 2e$ @  $ [ $ $}@\ @   `?@a `b8) @( 2 a ;  @ ((*@   <`\@1P *@! @   `?@a `b:a )@+2 ` @ 9   **    2$ @  $  $)  `@ $`\ ?   `?a `b8`)@ ?+2 a :` (@ *(  @<`\1P *@! @   `?b `8`* @ @( b2:` @  ( * 2$ @  $  $ $`\L (%: `?  +`?"` `=(@ ( 2@  (* ;``   @ @ 2S$   $ $ G/t  59w'!ጐ #e& $  $cZ`\H (  : ?+`?" @` `:(@( 2  (* ;``    @ 2$  $ $ ;a:  !(!)%!̖ؐ $ & $  $ ( \1 P2- @! @   ?c` b`; ( +@ c` @2@@ **@@;`   @ @@2  @  `  \3 P 2/ @" @  ( ?@c` `;  ( +@ 0 ((@c` ;    @@2  @    ` `  ` $`\$ Y $ \$ I ${r, " $ $ 7' {  35gb09"$ $7U& & $ ,\ (  \ @* \ $@7@) $3*?`\@4`P ,t@!   ?```:?- (  @3@:`  + +@@  t@  $ %`\  $$ $$   @N@ $ݒ`\@4`P ,t@ !    ?`b`: ?-( 3@`> * +@@    t@  `$ %`\  $  @ @ & " %\  $@   `?@` c; ?* @( `3@ : (@ (  +@   @ $cZ`\4`P ,t@ !    ?`f8`?-(   3@ ;` ? @ ( +@  t@  $ %`\$  $&%kX a@- !d-XL# $  2p @"   " " " ` `      "\ ` 㿠````&`㿠9 "h   Ӑ t" $  & $ tʒ  %#!b" $& $ & "      `   & $     @`    㿠& oǐ& 㿠`` `(^#\   5 /-$$Ԛ  `&` $  `$$ 㿠 `  @_~    `"`      05 "d %#!T!c<#H $ &&P` &T&X&`` C`/` -1c    #㌖ %#\  # !cؔ %b `& "   "" ` `- @'`&`&`` `.%` &` X` +`" P㿠` `  ``A`  `ОМ㿠 #\7/-(4@ %¸  ` N 7d`@ #X~X`L%l #\ T 7-`%&T% %TT  T`! T#\#(`4`%@ ƚ @㿠P`&)P &P? 97X/* Ԛ༖Ȑ % `(` wu㿠` `!    ``'`` $ ``#``@  X"" X` `` %&` ` ȑ-`1  7ݐ53a &ʘ  ` `/`@&` `&`&` 㿠` Ρ/`XȒ " ;5a|dp &'  ` 2 ] /$   ` "  9!+-a &0{  .`&`s ` ]   ` ``@ X@&- $ P$ X `X+ @ $  ( X(@$ ( 24` ,+ ($ ( (` ``(@&%`I  7b"b  &T$`    e`  `  `X.  @&`X.`@'  TT  X%5D`d,`@    $($T%@% (%&' 2M  ͠%((`'LŒ "? %+p7bXd &     @%i ט2! )" " 91""b &z  0 4 %  "  " " (`T$`TT%T""`T &T&'  0W 4L   " T`$T&'  ܒ  % 0)  "` # "($`#`(`T`&`T T % T&'    %`0   `  & ("`&(T%T`T %`T&'  z 0Ȓ  $`$$($$(T T`T  `T&'  @$W 8 /0  %`& %&   &`%T`#T&'  ``?  " &'   & &L2  `  & &42  #\ ``# bbԖ'^ 0 `$%`     `T`$T  " " " (" " (`T&`T`T`#`T&' @# 8 | u 0Ò  %  '`! %(%`T`%`T$($`T '`T&'  02  #  #\c '  㿠 ` ` `"@ J  ??&``&`` `  ! !    (  (    ( ?=@b  c;` b + * 7 ;`@  (  ?/@@@ &`&` (` ` &`&`` `75#\1$(#4 ' lllll㿘%`  " ''98! ,P??&P '`'` ` ̖" (0Ò"  ! !    0 ` ``` '` '``  P( P "^ P`&P    ` `  $' '      '`'``  k  '`'``  P" P&P 93!p1@!c@)' #D#\#HT ( ʚ  㿀`6 `  `C ?? `@`"  85``" ( `"  `  ``#` #`  ``"  `## `` @Ĩ  㿠``:`\9`&`\`` ``%``(` P`(P``P &`P`ϔ`P `P`&`P`P&`P㿠`      ` @% \` ``   `` ` `㿠 #\`"x 7 3/`c㌖( "x"t%-`㿠"x"|,"|,&"|"| &"|"|H+`'o "! 3+[c)c# (I  "x"t"t-@!C&"t"x&"x."t& 㿠 #\ "x`9 75#( "x"t&`&"x-@㿠 #\ "x`9 75 (4( "x&`&"x㿠 `` @XF    `$   `& 3`@ " 97 d5LX (٘  " 0" 4㿠;`  Ӑ` ` ( ` `ɾ#\   5 /-ؔ (4  `&` $  `$$ 㿠 `0`4㿠  @&  `   @ J &  㿠; a    o<$a0)\"x wҒ m̒ `gƒ ^ "x"b  Q `K )*!%%4%05&"93 #\!a) &"  4)'% #\!L`?ht)qm" 4Ր  &"  &"  㿠` @m` @t     ` &&`&`&  㿠``@`@   3& b&& &``@ʔ B#@ "?` ,`&``@ @&, c(`"?2 ` `- '``&`  8&  ` 2   7&&4&8 &㿠` `:  ! @   : `] &`  &&  @͔/  :/ `] &` !  &&   /@  :  `] &` !0  &&   !@  : `] &` !P&&  @s/  :/ `] &` !p  &&   /@U : `] &` !  &&  !̐@7# `:# ] &` !  &&   #a@7 :7  ] &` !``&&  7@ `: ] &` !  &&   @ݔ)  :) `] &` "  &&   )!@  `: ] &` "0&&   8 #`  #\    $`$` `Ц@   `` `"Ȁ`"` "\``"_`x ;`>`6"n `Z ȀfP`@ [<^6V`#\ ` `  "@"  #`   ! !     ` `    #`Q ` I`%3` `?  `  b8 (@?( `2` ``(* "`"` `@3`$ `?  `  b: (`*@`2@ *  *@) (" " ` @ 3` #\B#`Ą `#\  ? = a  b;  ( 2) `a @ +@ * @""#`= ? a  c`8`a + ) 2  + @* ("* "#`@`` ``"` [`"``y ;`?`6ro`#\ ` `  @   #`   "?"    `` "` "`` #`: #\#`4`#\   ??#  #    #`` #`\  #`    ' ?'    6& &LLhXt4`<Xt0H`x`/` : &"b  +8 " " "   '#\%!@`?d"p+A      `(@`  &`&&&b| ->"ߒ∖ +^̘ '`  +. @@ ` #&`  6#b  3'b%̐ + &А@] + &b&7@&; &c&/@ &  &# &@& &&@c&}! &#&@c &r3 &c$&%@(&g 6&  @ 6& p @  6& P @ 6&  @ 6& 0 @ 6&  @ 6& д @ 9&"P&00 9&"T&0* 9&"X&0$ 9&"\&0 9&"`&0 9&"d&0 9&"l&0  9&"h&0 9&"p&0  t 0 8(@hhhh H$hxhhhhhhhhh hhhhhhhhhhhhhhhhhhhhhhhh ( H#d #`, #h #l'H  )+#P-HD`+c8#p   #t    cx  #Hㄖ +mhH> @Ḁ`:/`         "xЃ ` (  6301 .,%%  @ + %  "" &&0' ' 0' 4n &"h #\   !#c#̘cؖ+y % '`  &`#  #\  ` c `+\  '  "   %`% #\      $LX+? `& $`  $& &" &" " &i&0, &"&" &" &` &" &" `7  ߒ `G  URO2`/`-&&’   ) &  " '`'`0&`&`0&`42w &" #\    + `d`,@  & %  ' "` #\     औ`̘ ؖ,@z `&`     $`$` #\   )`! ,@] `'` "   `%`&` &"+&"(", '`'`0J'`a$'`  )aH;/a0< ,` &"&""x"/   %L%0ޒ &" &"#\"'Xa|p,e@ &"V`'`'`А &" &"А"; "x 3  * 0!'`  '`'`0 N~ &"x &"t&"q &"m#\35"!a!,t@ ^ ' mR &"L &"Hm8 "x0R  &LF '`'`0P: &" &" &" &" #\"%ḘܔЀ,@ $p%#@Y   &" &"v '  @=  ϒ&" &"Zt&``@!  &" &">&В &" &") % &" &""x Đ Ȁ &"iȲ  %%% @ȐlQ &"K&"H&"Eِ' ' iS8 &"2 &". #\9"/b !耠@ ,DC #\")0b<",ߐ@ 0 "x &"  &"&&&& &Ԓ &"l ǖ`d%hlPA40,( ``  $   " $`$`(`&`$$(" $`$$ &&B &" #\9/"bl"H`-@ Z X`V T $  $ $(% % $`$`($`&$$$(`" " &ҒN`(9"  +b-;b -j &"1 #\%'")#@ -p[5$%! &" #\ ""✒"x-B@ A   &"x &"c(` #L4`@-"x    "x &"x  Ϟ  ʞ㿠  9a " ;d ;7^́# ctc` 㿠: ( 힒 &" '`.'`%'`'`$(,'` `  < 톒 &"?? ?娐= @L '``` ` "  j&" 㿘&"$)#  /-+c . #\75"3̔c.@ r  㿠  - `    @ ն    @KɁ㿠@V U㿠@O N J㿠Ԑa ?   @*`#@  + @  @ # "    "  㿠; @7.` (`@ 0   `  @ $@B # @    @`@ @-   @ *` #@ +  `  㿠 L"  &"t `&"x&"|&"@K  d&  @K d&  8@K d&  @J d &  ` `  3;c 0 P<`H   $ `$ d    p  " "    ``&`&d   %%  ````&``&`d `  ``?'`'` `    "" ♦ `< ?  b  e`;?+@ 4* ,b )@  % @% ޤ   !&`&` `♦ < ? @ g  a 8 ?(`4/,g @!+ !@ %!%!ޤ   !0&& b < ? @ b ` c;` + 4* ,b  !0) !4%!0@%!4ޤ   !P&`&` `♦ < ? @ e a 8 ?(`4-,e@!P+ @!T@ %!P%!Tޤ   !p"" b < ? @ b  c;` . 4* ,b  !p( @!t%!p@%!tޤ   !&`&` `7♦ < ?  e` `>?(`4-,e @!+@!@ %! %!ޤ   !" "  b W< ? @ g ` c;` + 4 / ,g !. !%!@%!ޤ   !%%  < ?  e` `8?(@`4-,e !Й+@@!Ը %!Ј%!Ԧޤ   !" "   " `< ?  g ` c`;  * 4 / ,g !( !@%!%!ޤ   "%% b < ?  e`` `8` .`4-@,e`"+@"  %"%"ޤ   "0" "   " `< ?  b`  c`;  * 5*@ -b`"0(@"4@@%"0@%"4ޤ9 В P ᶐ``'`'` `  3^`T ?& Ԕb& &"P"P@s ^t"̔&"T"T`@d  &"X"X@W ࠔې&"\"\`#@J `ΐ&"`"` '@= ༔&"d"d+@0 `̔&"h"h /@# &"l"l;@ a&"p"p  @  @ 㿠"P`"PH"T`"TA"X"X:"\"\3"` "`,"d`"d%"h"h"l"l"p`"p  @G  @G   @G ` @G"t" $㿘6 #\;/-@D`a4DP/Y  +)'@  a\#\!ht/Z#\နaa/[#\ @ ᨔa!Ȗ/\$  @@`@ `  @`@ ` + ```@`@@ `v @ڐ@ ڲ` -`@  #\Ԑ`?a/~&㿐#\  ; -/ b/)j '% ",#\<H /_j    `Q&``@`` , @ &   ` `  ``2 `  r   `ѐ@~ &.& && &豔 *&     `秐`T矒 &  $$(% % ("   T" T%  T# T&&烐 R.`   h1ݒ`(&$`($`$` T! T  ( `T`"T" " `T$`T" (&G`̮%`   :2 杒% " " &痒習 삒bT _ʞ㿘9   `1    2  `@ % /-)+ x#\"`{# ! #\b`?"b| '   #\9;57b"̖   Ğ㿀#`+)'b#d%"#h#l *#pت  ``R d@hlp/     ` > "     E ( b/C   2 7 7 *`7 ) ((`@ ” Ҕ 2ް   +  2Ͱ - 2 4.44/ , -s 2 66, 666-6*** ((`.P9'#x^3c(oZL {4c@ fhwc c ## iP)%a O#ؚ̖ l<&*27  F ; 5#\ c b Ȑ`"#\!`  v 㿠'H'L'P'T'XH㿀{㿠'L'P'T'XL㿀'H'L'P'T'X+zH  'b& 4㿀d  'L& 㿠 `  @!&`    ``- &`s  `.&@ &   `{&`㿐+/'-) `('@4 !! w eT "P~ a ;Cb "&@` ̴` &@  * .*` ' g% @ Ӕ*'&@`   &@  .++   @ '`  `@u'&@  x  @ @d'&@ h`@ `S'&@ ` W  ! `D'&@ H`   +`+ *`  ` +'&@ /  ``+``+ `*` * `+`+   % %'&@&@'   `*􀦠(5  `PT"%`t@ \`h!-> %#!(` !㿠'L'P'T'XL㿠,㿠'H'L'P'T'XxH㿠 @ n` @ hN @ . @ 㿠  @ M` @ G@@ A' `@  . @ @ {㿠```+a/N`@ -@ ܔ     J  ` J 2 㿠9  Ā +`̥> #a  .@ c  `:.z#* )  ^@>> ': ,,5 - @c*0( @@7 ./ @ ` B @  7gaL`Z@@=`:`$* - "@5 ,%- E@D@ n` B @ i L` 㿠;Ta!  <@   @  <   <@    <@ a  t  ,  ` @73  `W @'#!@ a@`` ݐ@    "  @  @㿠@ *'N :2#N `:2N b N p N `h H;0a؁  @s   @m   @g㿠 `()  `   2     @ J  C ` <'"@ 㿠` . '`   ` '` ` `$ `  ` '` `` `$ƀ `'` F@d (e㿠5 ( @V ('  ' ' ' ' ' ' ' ' /Uጐ(`5U7gЧ㿠 `)% " @Ĕ+` /਀  5` & W   & ?P #0bD@x!0㿠 `5% . @ ) `    ``` `  &    & ? #Xbl@9!P㿠 `3 &     @O    @K?& /b@!q㿠 ` 9&  & & & $ց7"@!㿠 `B!  & & `      `      @   ? ? ?@&  &  ` F@N (O"В@! 㿠ПgcȀ?Ъ 㿠АgcȀ?Л 㿠ЁgcȀЎ " 㿠  9W 7g@ & ;Vc;g@ 'c㿠;9V`# @;gc @ @5@r 㿘9   ` `@A?N  %< #!c# !)  @&?+cD3  3!cl/-P` ! 7g5V@O @@-  ͖ p@C @c?  %ܘ ܤ ' ' '//@" 3`@/ǒ? @O &` ?@G 7 @A 7Ԓh@?&`l`l` P&`l 㿠 D  ? ?& @ 㿠@ ;`@ܔ  ;?`@89  @` ```Dڞ㿠 T X  L` L T L *@ " T P*  P`@!  X & X  p.  X? L.`% X P d-`$ X& \& ``& X㿠 X`    Lݶ X& X?& \& `㿠 @ ` &   &   & 㿠'T& ;-|+)`` p "   S   N5`  @ 9 @7вρ㿠@c㿐; `ܒ c-ʐ$+)a! c"@J[#\#`#d/#h@< c;ad75HX c"@&7@ t㿠 h@>`l.# hl8`@.% l  &  >"@@ "> . [& lh # < %@@% @< .1 ^$@"N@($@$ D  D` H `DW2@/  HH&@`,  , 0  `,2 @  `0#@@Y N@''@ `4  4 `8  420  8&&@`<`  <``@  `<ؔ   ``@ɐ@&h㿠  `l l h  #  :%@%@ @: .; _@ "@ lM l h` `@  =$@  $=.+ ]@% l': h'`& h&@ h l l( l h#  l & h h  l l' h@& h  h l& h` h &`@ >""@ > . Z& %x  `8 8" `4   4  `㿠 ^` `p`p.`@i` ```JL@  ``K@M "-` ``@MO?$$  '@@$@` ` `l@-$@` ` ```  `` "   ` `  `'@%Ƹ$@`l0``+`q` `l9  .5 `lX ``Z`l `N`l`h $ < %@ %< .1 ^$`l'`  `  ``%k7 |   X# bg1X@ @:8`"@!.( @EL@` G` `l@@-'@ `$ `$```(  `$` ("   ``(Ґ `'@" ` @ `'@"`d` ``@f  ƚb "5 H @  " K ""   H@ ` " I  2" J `(  H@ ` " I  2"   H@ ` " I  2" J `."" H `!" " I ?"" J `:" H `. I ! J `?  H `:" I ." J `!"  H `?" I :  H@ `  I  2 . p   H @  p  p  p K `y pt I  2  p  H@   p J@ 2 p   p H . J@ ! K ?  H `: p  p J `." H@ !"  H ?" J@ : p p  H @   p J @ 2 㿠 O@@O /@㿠 O@@a /@㿠@ 'PP@`@&P㿠 t?`d`tz`d`t`d`tߖ?`d?`tؖ'`x㿠; a    3)Ӑa'!ᰐ$ !7АΒ"`5/ -ܖ$` 㿠    L` L     `? p -@H   @=3b7 5ob, $^    ’?  #\@ "HP`$Ԛ      & l& Q`  V  j @4bx7 !%"№"$  )' %  ( "#\@ $4$   #c@ &   ,@@z @@t& d d& p L` L㿠 n`  `` `L`]`Lu` `p+ ```@64!#L~  '~t%#Xch %" `/-<`+`  #\@ `%%  ``) ~ `@@@`@@'`d'``d'`p "  @ @   $`HT                                 ` ` >3?b    `6 9^#@  Ĕ @'` @`@ @` } `H} @,`< %bq  -? @ @-p}y   }f| %nS  ~   T@    \ T@ T@ΐ   `T@"  +y `T@  # 7   T@`} }`ഖ`Đ%  \@  `    \@v \@} ` \@j"  E. \@^ {#  q \@W`|ǒ +|a9 ! %    X@2 O `  X@# `X@* ` `X@"  . X@  (#   X@ !8|t |aa`DT%N   P@  ` e `P@ P@א ` P@"  4/`  P@ $` >  P@a|!  |!጖% `8 4 b| 3{b,-"  %ߘ r#a{ ;'){ܐ!!Ԗ! %ʘ %^a@̐   |& `  ^耣۹+ d& x& t& d d`  d" & d p + d p!  d d  d p@! @D  d t & t  d t@ t&& t p& x' & p u? p& d d p d& d d  d p   d   d d%` p@@# d t' & t  d t t"`& t d p& x"& d! & p      & '   d p >/ & @ d p@  d   d  d p @  d t@ t@& t d& . p d& p & d& xG  p@U   G: `1   p- ` `  `?`    W  %b '?& )@#\L"\ &H@ ~. &    l p d  d l& d d l@  d l#& d d` p` d p@ d & d  d d  J @ dM .  d+& x& d d p ސ H d p0"  p x  H@ HҒ`& H H@ H  H@  d H@@ H & H d  H@ݔ H*& H  d  H@Д H . t d d & p4& t p& xh& |e H a H@[ H@ p  d d p@   d#@  d H@@ d p d@& d@& p& t& x5& |2  `* } |u & |  L O]Q ]RhZu  X   \?. X& `#`& \ \ `& \ \`& ` X \ @6& ` \ P. \ L*& d @Q \ L*  @Z @& p& t& x r  p k t d t& t& d p& t& d |  & |k d%\> > D<  @b \4a clf d(e.x2k8ru lthVd d ~ & t&  dM@@`E d   dH@9  *`9  @i p d p@   d d p d  @@    d*  d t@  t`& t d p& x`& d& p; d   d O?  d%`& d d d  dH@  d" & d d   dJ @   dN   d& d d& d  .8`\ d" & d p@ J ` ` p@  N @ 2`  d  p@ & d p d%@ t#& p@  t@& t& x t$& x d t%@ & x#& t& d p& d d & t d & dz d  & dr d    d& d H@@L +& x& dV d p& t dh& dF d `& d> dX& t t p t? d + d N  J @ & @M  @M @`&  H  && t d t d t@  d t& t& d H d tQ' t x@ H@  H& H H@ H  H@ @  d H@@? d x H@ H & H H@ H *@  H@ H d @ H & H  d@ H@ H.& H  d @ H@ݔ H-@  d t   p t@ @є  p d& t&& p& xo d  d]Ԑ& d& x]  du  nhbZT1&I @  @@~% "@!@v& &@ @p& d& x; d * d/]& d& x  MO?㿘g ܬ܀`   `%"`h@]bt% ("@Œ a 3bpyb  ?"+<bvnFv\5b'I: v[3#vIc( # #'6' vH v6#%㸚Ȑ'# `v5 /v#,; `' $ &`@a>$ @`>`Tvu|5``p(~@w   u#u> `(~Ϙ$ @)>uڒu9 ؖ (~@HwY&`u3a$!u>;!a(~&@>жaDuulPa`(~~@w"! apu#us>|a(~a' @>ظ?!ul7uZ%ԒĐ(~G@ڐv'`auP53u<>!a"(~* `@>ຐb0u5 u#"X<L(~@v" #b`u"u>l|(}#@M>貐%t9t";7bĐ( }٘@lv}$ btc5tΒ>3b( } @>?c tǒtcH #,<(!}@5vF$`$Ptxt>#\cl(!}$$@ߐ?7t!t~#9;#c("}k@v&`(ctt5t`?cԖ("}N (@?`tY#tG`8   ,(#}4@ǐuؒ",@t=%ht*?L \(#}&,@q?;`t"3t`!9  ($|@u&0`ts? Ė`Ԑ($|! 0@:?(?assِ(#!a (%|Ƙ@Yuj"4!0sϒ7X%s?,L<(%|'`4@?09!xs5s3!a!(&|@"u3 `8as !s?8ᴖĐ(&|r" 8@̐?@as}sk#b ('|X@t# < sa9"H7sM?D%,<('|;$ <@?H?;bhsFs4b53tb((|!@tŒ @bs*bs?P "ⴐ((|$`@@^?Xbsr#(){@}t#D%r;c89rߒ?\7#,(){͘&`D@'?`!#XrؒrƐ5cdt(*{@FtW Hcrr?h ##(*{"H@?pcr#rcܖ#(+{|@t $L7r3`(;rq?x9`  (+{_$ L@?5HrjrXpT`d(,{E@ؐs! P`xrNr;? (,{(# P@??`r3%r!#ܒ`̐(-{@s&T9 r!!3r?;`a (-z&T@K?a8q q!`DT(.zט@js{" Xahq!q͒?t(.z#`X@?qŒ7q%#a̐(/z@3sD$\9!q!"3q?;aa(/z&\H` D"&/`0 ,"/` `84" /`@   <`/tM( 4 ??Į?̲?"?ؤ????" ?!  ?  `$?&(%`,$ 0'`4&8$`<#`@"D"`H! P T&X$\& 㿠 "1? `%``%``Y sb\`` 3K`   `뜐`` ```` ``p,```$`  ``@` ``p.@```` ```㿘#`#\ @ 㿘#\#` @ 㿘#`#\ @ 㿠 #\/-+G ␔b) s &꼐 'టĀpk  1pY"7)"к )yF  b&@ &@ &@& &h@@ߒF`D 쉒`  P@ && &&+`&,@&d&p&&&\&&`2&`& ;l ``:  &>"굔 &hN  %@.M`` ꢔ `꜔&h`㿠 ;1 co   o0c$ ){x&!?&)'&? P&T !&T&H&t&x&| &LT &P8 "P%&X&\&`&lז &#\#L`ഘcp)@ r &&ː&V&&଒&@퓐 Wg"` @퍐  g!#" 㿠;c|oO o<#c )x)  X     LǢ` X@ H& X L P `9g   p-)#7g@J @G    6 3   ` 㿠-r+ !a " T  " ?" t" x" |" " " " H TQ ' L TM ' Pmc L? P!  P ' `' l' X' \' ' #'  @k  '  @d  '  @0'    P7 L42` `+&`?'   ' ' h@5@1 ے`  P`@ ' `'  '  '  ( '  *` @' d' p    t   `i躐'% X    LϨ  X` H L P W  &`  p.`@룁 X    L  X  H L P &`?:  &R'ɔ ' hN ^ \&BN +c趔 -谔 ' hG㿠;pc `   㿠;`pД` 1p D5o& &< h㿈@ @`@@ @耐 @@@@ @@1 @'pex@@@@`"` @@ 0 @@븒+@붐`@@@묒 -@몐@`@|@띒 /@뛐@r& `"- &`  ? " " " " " @_@]`7o@Xx;g@sU ' c& ` Ԓ &`㿠gc耢   㿠gc耢  9p, 㿠    ;o`  `"?  M" "  ]㿠;oԐa;ob< @p  F@D E㿠z` >` 7g`7g  'h / h4l Xl5a@L  Kuo   @0 `!xly ᜒle!  TuR  / a    d` lO /- $ 1l6!ܖ au%   ׺  " " " "  ;b o]㿘;bpl ;?)'l "%|  t c?@_ @ -`?@U @-   =9q !}㿠;h`` 3q7h&a n 1/"ܔ8 ( -h%`9"o㿠;h``  9h5h' 1h + & 㿠9"k ck"b  t @R " 'gh" " " $? ;3c$;c0c< !#\@ n@ Ғ-Hkg 7l/kS1#T` ! tAgcc``    Ȟ㿠#hP@` * 'h$@ϐ#;9`!,@M+``c@\`&@9`x+@`aP@蜐Oܒ@-@6 a0"?`b' ' ')  ,';`  '//@+``c@`&@ݐ`;h '`㿠;h5@P`  ;h@  '` 㿠 ;@aP;h'`   @㿠  ْ 0  ,'@` В @ 0'жЀ "  "   " 'm}2  ` "% 3-c   @礐5C#\  #`#d #h  @L" 4;w" aْ&㿈  ")  `     +C #`b  #\  #d #w#h#l#p#t  @ " (" 4a$  㿀 \ `"'  `0 @  +C #`b  #\  #d#w#h#l#p#t#x  @ " $" 4ax$  㿘 ```+)`4 D @@  7C  #` #\   @˜ " $" 45w@M%㿘 `"2 )' H\  ƀ  `"" /-`p  ƀ @ܐ;C#\b #`    @" 47w" 0&  㿘 `"2 )' t  ƀ  `"" /-  ƀ @棐;C#\b #`    @N" 47w" 0ے&  㿘 ```"! +)`   @  7C  #` #\   @% " 45w" 0%㿘 ` "! +)` Đ  @R;C#\b #`   @" 49w" $!%㿘 `` "  +)`Ȕ ؐ ƀ  3Cb #` #\   @՘ " 47w" $b%㿘 `"" -+ܖ`  ƀ @;C#\b #`    @" 47w" 9%㿘    ` & "9 #\ +   @@   `"$ #\15! @  /C #` #\ ;w  @g" 8" ," 4a%``㿘 ` "! -+a ƀ @唐;C#\b #`    @?" 47w" $̒%hВ @傔 0'д  "! 3/a(  @`;C#\b #`   @ " 49w" $!&㿘 ` "! -+,a< ƀ @8;C#\b #`    @" 47w" $p%㿠;#\9a@;aL@ !\"k   㿘   "% #\7+pa ƀ @9C#\" #`  ;w@" ," 4" 8a3%㿐 ` "7 +)a!    "' 13a!  @Ð/C@俐#h #d  #\  #`#l@h" 49w" $!&㿘   "8 -+#\aВ ƀ q "% #\17Ԛ! ƀ @~9C#\" #`  ;w@(" ," 4" 8a&``㿐 ` "7 +)a"   5  "' 13b"4  @E/C@A#h #d  #\  #`#l@" 49w" $!w&p \ `"N "8H @   `"; bL"x @ +@b|@#tC #\    #d #p ###l#`#h#x#|## 1"x@w%%(%4%㿠 7| ( " "  " -+" )'y" %|#|L '`b#\"#`!C@ ib@%d'`"  '`  '`$`@% 㿠 @% `````@( `@  i F@〔 ("  " " $" (" ," 0㿠 t qo㿠 ` ` @%r  &  @% & &  `      0hܝ㿠 ޒ;be/0e|-c $3ni ;wT%c d- @ŀ `a 4@{$T$4o(H(4a, :4#\,Q0*04D#@➒cl27((4/hJ)9hD#Ȱ"㿠m  @⎔ '  ' ' ' ' ' ' ' 㿠  `   @y u @q   j g d F@] ^㿀'T 'X `  '#\%#`$h. !C"  ե ՟T `?@  <  % " 8<& 2& & &  & % 㿈9 #\ ,9/D  <L$)g #\'%` `$ת#`?gޚ`@ߒ`?C#\ #`#d- %#a,dO dd<!@aP $m)`(`(`4`!(ؐ ;`a|g[X ' ' h f   e"  / g"/N i䀦 "Ɩ/+Cb  ϔ g-  D%% "Td:bxC#\b #d#`&֮g b@cϒcleR . " " 2A ˞쀥 +fb   &&` $ƀ  '  #\C#l" #t#`#d#h#pU 2%f#Cb #\C 2fŐd /C#\ #` "GE8c?T)c,cp+#Lc\%jl ` #c(=c'㴐%ql    4  f:9C#\" #` ʘ 205;e̐` %(bޒ`1b#`< L%k ( ܐ 4 (̀ 3ec-C #\ Ո eeࠁ `)e  8R `b'b{ !%ki#` Ԑ@#dؒ&#\H@9eQ!H&@ % Ѐ@`?;eAad ,  4#\ ,ĀЁ @!!b= b+/aᬐ%k   @   ` $} $y $􀢠V    @#d&#\#`Ś $`@`? ` ` ۢ ,d,ZU?P' JGD$ $$$$$ $;bd ,  .``$ 4#\@ ,Ā  4$b(#\  , C" H  @&Ѐ @ `?#!dAH d9"h 0` 0 4P dzb,!C"  #dmbw;db 'a 5-a+)b"&i@& <a5t3`1cP#`&i    ' 㿠  &  75㬠 = ` & &  `;c;c ( `מ㿠 Y  & & 㿠;9#\c;cԐ@ #&d   " 㿠;C`b  | ` b `` s `b ``i`b `(a`  b ``$`` Vp )CΒ 0&"  (  2 % &@"   %% `" &@#\ %%&@"  %(`" &@#\ژ  % %$%%/! +&@"  ܴ #\" #`&@#dҨ"  *#\ 㿠$ `;Cb  Ė $ +#\)'c  @ c $ `$$$($ $& 㿠 `";` `@3``;bX`( 㿠 `   9`&``9 Xb7㿀'P'T'X{9P   ` }J|ؐ @{㻀'X `XzӒ$@ܢ+C@ܞ#tb #\#d e #h #p#x#`#l ;C#\b #` e    "   "  `   ~5/- #\@ !9bO   `^ƒ bZ@>&' ^ #C !^!Ig`>#`b  #d #l#t#\#h #pmـ a^7^v !Ȗؐ!]gc)!E @H)9"^f #^Tb@ 0!egA%/Y'@-PT#\@ @"bx^479"^ ""!rg )"  ^/<#],c!yf@Bs@A ;c\]5!]c+#lc|!fԘĐ q]ے  ]Ȓ!fZX`<]Ēl9] \ L!fD@ ϐ!|]7-/#]`!f%Ș̐ f"@誄D } D9@!, '`   9]fa]S  !!f@@y]Oa\]<<L!f)  pt  `5#x @x#\ D@![? E薃 C` * D@!DD@@<@@!I\ a܂<@\` !!̐ !eΘ @@`^q @ZC#`@ #p@#\`   #h#l#dx @ D@@Q`Oa@\5p!\!P!`!Seጘ sa\'!" \"!et)T"P W8'7o ' '   0' )    J  " "0    + "kZ "h    5   " A "    s  H "  "[@ % #\⼘̐"_  1\"ܺO_ǔC ؔ31 `*'&쀤 3@ocd;@kcx#l5!#`%C#\" #h#p#d v1C"  l#\"#"%_7#[c  _qC^c<M@  #\|#"r_'C[cؐ_P"#\ #` #d #hZ@ &@& @@􀦠 ` "  "  "  䀊``a b` 2d@ '`P[I    ' [5+ ``p "d#䀌= 9 !  #\  "^I1䀊 "  ` ` $' ' ,ZC ^ ! %  #\ ܘ"^d  Z&^p! (@25   #\# !(a8a"^<  '  HZ ^tF9 @G%  pl#\v2>@Ԙ` fC #\" `#d#`0]_ ڐ @   #  #\!aa#]ߚ  ' ZXᴪ^  !ZX 9C! % ZD! ܖ # c2" #\#`  ki 5 - 48   @؅  @I  )  #\ 3 "XhbL#;]~` +b; ; bxY7]    % "1 @z!  ⠖"#\f p \  / C#d #`#\ #p #h #l̏ |z Y + # ܐc3 YԚcb #XbJ `E!Ԁa'ԖԀ a''@ٖ@עԨ4    #pct?  3 #c6  +Cb #\ g#` #d  5 ; 0c4    % #LH  - \@   #\C#d#pb  #`#h#l #tWU9 #Y 5 ܐY   #a{%    @R @֔ ' + X`\  ; 3 `l`p }   ) `   q    04  g [@  $   @ % -   #\t#\(`  X\c5C#\ #` pUT @ 5 'X  ) 1 !Xy ! #ag  #\# !,<a #[` aLX_\!@8`! @-   `!d#\  [&   @  )  !|#\a!$[ + Xah[C#\b #` VU  @ - 'X  9 ! % "W  $`  8 #\,"H$[d bXW&[p@B81 5@l  "l#\pV bRs  Z!  bW  ; ' Wb ⨐ $+` #\@ % - ȔԘ$,[  ) W"Ӑ[KC#\ #` W q l   % #\- #t$HZۚ`9 #WR[~@ջ86;'`` &`pt' ' 9C#X%\"` i`$`P# (`" x> & &$>`""Ζ  `5 @Ԭ3 cĘ#\ܐ   # #8c4Д   + cPcLƔ   YԐ  O @     #\#$\ZT  V͐` Z~aC#\b #` ɜ@~Q & @& Y@@ "- @ +% 'TV 9  ! V d t $q_`    @耐&?  ``@耐&?(@耐&? `$` '(``'0'4',@ؒ(2?  ! %  #\  $Yɚ `0) `#``  ` $  0`Vi Y} 5#-@Ӳ%    #\} }1 3 !aӔ - X( \ ) !U  9 U!8; # aa( $^ј @   #\ !LhX$YN   UǐaxY}[ C#\" #` ȕ }J &@& R ``    ``` @ &?` `@&?  ` (@&?` $ ' '$`@ 2? ! %  #\" %<XΚ`2``4  `  $#\0#\ b0`U"l X| 3`&@Ҵ! ` "`\#\) + "xb|ٔ` # ) a!Đ͔ - ; `ؘaܐÔ ! Wѐ!L @   # " #\b%RXQ ; TʐbX|^C#\" #`Ǚ% T  c$T   %\#]@ ) 'cDT  9 ! #tT T#d %^]~  #\# 㤒c%`W 1 #Tv X8| @耐;ch@ " 9@8    #\##̔ؐ%WϚ `cTEX{ِK@  #\  q`-C{`  f#\`#d#`ʚ- V; `8T 9 ! % S h' HX %\  x@   #\ %Wg  S)W{sC#\b #` ƭ $"F``  ! % #\' !8DT%W1`# `adSWj{<a5ha  o#0#)<##(! ;5`@`" `@`@ `K /  $!h3 $`ah+@ $@ʒ8U  "pt#`#`  #X \ `"`P# (  ! x8 $> "`"`@ѼX  Xg @ @ʔ @@ѯ\  \!gے  @к :`a  @  1*"#\X @   : :  ? #l)  a*g / *"X @  > >  #@l+  +g /P @z P  a@q |@W |? @f |P  PI  !@Z P -/PP  c(PP @@ d!PP bPP  lPP  s PP ?" pP! -P r` -P whP @  S sPP @ -2 xP  -P r -P w$P  S sPP -2 xP` -P r  -P w  -T x#x#|#t#h #l##l$#d#p#\#`#t##f@Ϧ@ϣ#\C #`   `& "`@ω@φC#\" #` `& fd\@}@~   " o1Coy#h " #` h#\ #d#l| n(f`  + ` Z- 3 `a P T @  ! %  #\"" 0'U  Q@אUOy!C#\b #` \~"}- @ 'Qz  "# Qf9 b" 'ZT  #\  "ԒȘ' TӚ % QK U xߐ@耐9@ے8   #\) #$#''T + `c4Q$n Tx5* @θ1  #`\#\ ; - cx|ݔx- SXd @   #\  #㜐'7Ti  P#,TxvC#\ #` ñxf &@`& n + @@ 'cP 5 9 1  P   'LY '  L#\0<'NT ` \Pא TOx!`! (@ 耐4   #\-  t'ZS '+ ``Pc T%wj @1   Ě#\' ; 5 `w+ S)c  @   #\%  'iS ) P!!kSwC#\ #` }"|- @3 'aTP # 1 + !O tad 'uX  #\ ᴔaa'wSg   O) Sws@|耐8@o8   #\! !ܔ!'~SB5  "O SzwL-+`@M;  b40#\| 9 1 "L"Prw.:- R~, @   # "T bp#\b`'R OvS8w C#\" #`E~|   #\) "ȔԘ"'RӚ` OKS vߐ@1+ OF c<+ O2 c,'X -# 8 @' \c`#\v1 #xO % O 㘒'W'`@̆@̃#tCb  h#h#\#`#d#l#p#x駱v! QҐ"M @     #\Дܘ#'RR # NːcRv_#\C#`b #l#d#h~3@85'@4'@N 91pN ` P 'W!  #\  'R  `Nʐ RBv@䀐2-#\ؘ̔'Q`N^R u'c1 @3a#\ " ;%a8<uu3Q"` @ 9! #\!@!L!\'Q  )N!leQݔuC#\ #`"-@'N 5#MĖaԐ 'V3! #\b'Qa$M# Qum@e$4 +9#\"8bD"T'Q@ -bdMQwuI@J∘"#\x'C* & @@#t h#\#`#d#h#l#p#x:u$-Ph @ ! #\b"(P %C+M_bиQ!t#\ #`#d#h#l+ @'@'cMF HM2#8( ('V#x㈞ #\cl(+P 9#M_ Pהt@˷䀐353-#\cȘؐ(1P}`1) #L=Pt%` @ʆ#`#\ 04thtfr O"1 @  DT #\`8(EP6)C-LdPptBܪ" #\#` }2,`%O #\9  "P  ;  Lʐ PBt- `04 N @&툐3OQ `  6s@ @ ے㿠 `  @ʬ@qԒ ` @  F@Ĕ sŁ  @ 㿠 ;s 97" " c <Đ@ Y&@ʽ# + a@ɳ#;@ɭ#cl.c /<5(@ɮ /  & N /"& . @ʗ&`9hh@L  @i$L.@Ԑ<  h@u=#ph@h#@g$39N``/  N` Oh Oh`@-@*h@ - N%9/ @Fh@C@> 7;9; @2'` 㿠qQ    Z qG&``r[  &`  %  \ & & `@@  #`@@  #``&  㿠 ` ɐ `&&㿠  -+)&`a$ !4 Y& '`& #\ 6N 㿠 #\  9 75!DTd a N #\` - +)ta! bNx  pА  '`  '`'`'`'`'`㿠 `/ N `  `& qqǐ q㿠  '@ ="    & 㿠p "  q㿠pt. &`&``     ` '@`  㿠p[ &   ܔ   qf&   '  㿠` `& `& & @! 0   &  `   \ & <& @ȁ㿠    ` `" ``zŐ`` ` 3aJ. ;Jb51!  h S㿠ː `q q㿠 `  `( `( `, ( - bI#!`Ib8," tR՘ ``$%PI"-`+)IАxb\"l tR /IВ 9I"53b tR  ` p @ *` `@  ` ` `+ `  ``  ``" 2 ў`㿠 #\9;7b@ " L 㿠 In  # 1c8% IV#, RE   `      `/`IE c c`I/l#| c R`v `  < $@ #\/`5`Pl| @ L I ``H   Q``$@H `H Ԗ` QӘ &  2 *uS@% *  $`  $`  @/$` `$` "@u/   < $@ #\-`5cĀ ې@ L H c`H# # Qy``$@H 7`Hs 8, Qa #  (`uP%(` `  $`  $` `%  $` @$` `"  o5㿠    <&@  #\ $$a4@  9K !@H H hL!\  P $@!H #!Gaᜒ!  P  $@ -`w@U'@-` `  &`  &` `% &`  &` `&  ` #`   *  `,G 㿠 #\97/`?!И K &f㿠 ` " "  ` <`!!G "> '%#Gyb ! Pg ”)"4Gr "! /-\+G\@bP ! PJ  @& @      㿠 `  `\n <"n 1  xG6G#b b"! P $@G#G "ĖbԐ! O %G +Fc )'#! O  <> @ `' @ 㿠  ``\nB`<"n=`2 `TF˒ Fc| c`#p!O   $@F# F#c!O !#F +Fc)'#!Ow `<@Ҕ`@``'`@ @ ` <"@  @㿠 #\ $#!\`0 L@ !  Iƚ `hFN 7+`)F9`t  ! O( `-`$F6 5/`;F!К`Đ ! O  ` `@ ` -`tU$-`      ` <'@  ` 2 ` ` <@ 㿠 #\ $#!4a!$@ !> IK a@EӒ -EhaL\ !>N $aE ;Ea !a !>N  "  -`u U %-` `   @    < &+#\)%a!!D@ H #aEr E_$b !DNL $ b<EY EFdH"X !DN3 `  2   `   ` ! `! `!  `  ``   ` !   `#`" 㿠    `'  Ā'D -+D)b" !MϘ  <&@ &`.@'`&@Ğ 㿠 <@ `  k <   \\&@k ޔ    `  $ƀ㿠 0`  v  $ vi .bD{ Dh#!MU  $cDd"% #!DO@c$#4!M> 'XDO -D=+)cd#t!M*   "  k  <&@kk㿠 0 u` `$` ``$@   @&   @`   ( ="   `     㿠.`9*"`U@5i`9 # `"   `  + *@ 4  ??4 `?4 - `? -  -  -    &@` ``/+1   = 6` ? .` ?. ...      =- 2 `? 2  ?* . ? .  .. F#.㿠@ސ* '@.=` @= &``i&  [ %(  `=% =! =  =   @  + * ( @@3.,3,+  =+ `=' = @ @-@3 .    @  + * 6 .6,  &`㿠@ch``  9 (  2` `=2``.@ .㿠      0    %  "   -    ` "   " ` ` `@ `   && 㿠 >^̐ ^ʐ $^Ȑ D F@ i㿠 $ _7 95#ظ`c_ Y`9BD B23 c K _Ӑ ې  & @ ^֐ `  & p& `   Ā t& p@y  @   |`  x   |& x@ l` 㿘 d`    h  ` l |`_x   '@^-@_ؐ'   (`(- @`  @ #\ @`? ଘ  E '@^2 @k_'@' \B`:@  7_'   ((-@ `  @ @!'@^Q@ DQ  & p& `  & p @Đ@  _Q & p&    t& p`"S @ _:^Ր#! #\`?xa4!d!KD & h_3' & p`  `'` t& p ] d& h$ @p `0C  & p& `  @& p @Z㿠   `"79~   Cጴ !D‧`㿠 -h7 "  ] ]`$]`D%`@ /%``%`d%`h%`l%`p%`t%`x%`%`%`%`%``%` ;@& " 㿠 & &  p& ` & t & l^* $" d`a܂ 㿠 @   '`@^ `$`㿠] $;c@  & `㿠 D\@k $ ]/]@ 7CL ^G]Ր\ ; a 㿠'L'P'T'XɔL C b  㿠;#\/b8;bH@ \"qCy & & & & 㿠&`x&`|]`$ `|&`x`@㿠'L'P'T'X@L㿠]9C"    ͘Œ]ߐ `6*6.6..]a"  `  @  `  @  x` x @㿠 $`;b  ~?& $㿠 (`;b  ~2& (㿠 ,`;c$  ~%& ,㿠 0]8` l lp h   & (?][@]8\Ȑ㿠 l`\Ր%7 p#\`?┘b B  lp   ``` ` l \/&  ,**`(`@   p@ p# ``  r `nl lҐg\  `&@[ t ŀ \g  O\ѐ  * *`( 3\S &`@ @ [h\C *\ p` p ŀ$[?  q t   t  ( & $?㿠 l`l & [tt@㿠 & $& (& & ǐҐ l` l㿠 |`; | ƀb9}"7}$}Z 0Z LZ F@ e㿠  e ZlZj0ZhL%  %$%(%h%t%x%|%%%%p%,;h%a @ 㿠;ha5A8" ``$b㿠ڐha5A  h & hY㿠Đha/A ,ϐ7'[j 0;@  &,㿠ha!@#d LZ_˔0-0[IP[E c@[[9ZU [.70P ['9#@㿠'L'P'T'XL C b  㿠Vha-@(`13" lZ/`?  #\``"@Ě ݁ 㿠;ha 7 53/hx`ct   2 @`@ + cwd  '@Qǔ`ش 㿠1h !9h!`@h"  㿠;ha`8 ha @Q  )b &`. /h`@`$`@b`$ `c&` ```  㿠 bn  '` ƀbb'`cw ` 㿠 bG   '`` b9'`cN `ƀ` @㿠\  @ uU@b?tŀ@`# @  €   @ @  @   @ @|bځ㿠 bbԁ ` `  ` `  `  `  ` 㿠a &`&/@`&`b2&㿘;`>Œʔ͒" H;j" &.  c" #"  v" "  X㿠'H.'L & 0  & ?L 3 &  L @@ L@@@@L%'LL`@  @`@@@L%@'L@L@㿠   7` ? -`? @ @d @ 8"@    2` 3 4` 4 1  2. V. P. Q. R. S. T. U. W@B .` 0.` 7`.` 6.` .` 5`.` 4.` 4`.` .` 3`.`  2.`  2`.`  .`  0.`   0.` 7`.` @UHFX` ``````.(- "`` ` /5ک x:1 #V@  @@,4Ș@ `۔ @ @(` 0`/0os̔ @ *`2` =_#@@@Й, 4    *.6ضԚ@ * b@ ?Q/ 7 ܴ a@ `&/`7` @@@ `ؠ "=, 4 @  @ c .6@ @@ ?ָ #/ 7 @ @ @ "W5/`7` @@ @  3, 4  a"     .6 @3?f a@    / 7 @ @)P c@  @/`7` 3m@`! +`3`  @ = @ab .`6` @30, @c@ +` 3` @   @bQ .`6` @3:m @c +`3`  @ 5IJ @`] .`6` @3 @`S +` 3` @ 6(y @b .`6` @39 @cȲ +`3`  @ xs @a .`6` @30 @ cֲ +` 3` @ =5C @a .`6` @3V @` +`3`  @ *x @ a .`6` @3?; @c +` 3` @  @bٚ .`6` @3#J @ ` +`3`  @3?@aB +`3` @3!}@b +` 3` @3gX@a" +`3` @3?yN@`   +`3`  @3)/@bD +`3` @3@c +` 3` @3=Қ@c` +`3` @3/@`p +`3`  @3 &ߚ@bƘ  +`3` @3:I@c +` 3` @35;̚@` +`3` @3"@a +`3`  @36u4@`9 +`3` @39@a  +` 3` @3蟚@` +`3` @31+@be +`3`  @3= H4 bD@  .`6` @6 @ʿc@  .` 6`@4@ @ *㧚 / 7 @ 7@-?$9 , 4 @ 4@ V֘aÖ@  .66 @)#3 @ @ ,` 4`4@ @ ? }/ 7 @ 7@@%!aѨ , 4 @ 4O@.6 6 @;?9b@ @,` 4`@7@@/(P / 7 @7@@  , 4 @4+=ߘb@  .6@6 /N"5@@/` 7`  4& @' ⻖@  /  7   @2@ &  & :ᴐ㑚 , 4 @ @& " TH;j" X&.  0c" #" "  v" "  \㿠#\``  - `(   .`@ @ `/ `7 `@`/`7`*`+ ` ) ` ` . ` 6@@ @ `/ 7 @. @`) * `  ` /`@7`.6+` *@`. `@ `,` 4`@/``7` . * @+@ `,`4``@,`4` (`@ ( +``-`5@`@` ,4@/ * `*` @`-5@  ` `-5+` (+ @ `  `!(`0`- `"5@`#@, +`@*@ `$,` 4`@`%(`@`&0` `', +` @*@  ,4`( `),``*4`@`+(/`@(`   -5`, `-`., 4(``/+`(  @@- `05@`1- 5@`2+ +``3 /` @  +@ 3`4@ `5-5@`6/`+  `7,`  -5 @@ `9+`83@+``:+ @`;+`@ @ @@,@4@  `< -5`=+ , `>`?,  @ +`@3`  ,4, 4  @ + 3 @ +`3`@@,`4`@ @@ *2@ + 3  + 3  @ @+`3` *2,@4 @ + 3 +`3`@3+z㡚@*2@ + 3 @  3+@. 6 @@ *2@  @3+@ @@.6@ . 6 +`3` @ / 7 @  @ .63`+` @ *2@   / 7  @*2 @+`3`@ *2+@ 3@*`2`+`3`@.@6 @* 2 @ *`2`@@+`@3`@@@(0@ * 2 +@ 3@+`3`@@(0@(0@(`0`+`3`@@@@3+@(0@  (`0`@. 6 @.`6`@ @ (0@(@0@@+3@ .`6`@@(0 @@-5@@@+3(`0`@+`3` -5-@5@,4@+`3`@4,@, 4 @@ @,4@ 4`,`@@@,@4@,  4 @ 3`+`@@.6@@@4, +`3` @ 3# `ܔ ,`4`@   .6+`3` @@  + 3 @   ,`4`@ +`@3` @*@2@  +  3  3`+`  @) 1 @   *2@. 6@@ @+`3`   ) 1 *` 2` @ @*2@@+` 3` 3`@+` @ @@+ @3 @ *2 @+ 3  @* 2 @   + 3   +3  *@2@ * @ 2 @. 6   @+ 3 *2 *2  *2@+ 3  + 3  @ @) 1 @*2 *@2@  @* 2 ) 1 ) 1    (0@* 2 * 2 @ @(0@(@0(@0 @(`0` (0(0@@ -5 (`0`(`0`  -@5@ -@5-5@  @-`5`@ -5-@5 @ @- 5 -`5` @+2+a֧3@.6- 5 5 - ,4@@ .@6@6 . @@- 5 @@ ,@4@6 . ,`4`@ - 5 @6 .   ,4@@  ,`4`6 . @ @ +`3`@@  ,4@@6 .   *`2` +`3` @6 .   *2@ *` 2` 6 . @ @ +`3`@ * 2@ @6 .   *2 +`3` 6 .   *2@ *@2 6 .   +`3`@ *2@ @6 .   *2@ +`3`  6 . @ @ *2@ * 2@ .  6  + 3@*2@ ( 0 @-5@ @+3 (` 0`@- 5@  @-5@ ,@ 4.6@ -5 - @5 +`3` .6 @,`4`/`7` \3`+`@&\&\ & \ @% \`%`㿠 T T@& T ? T& T T X& X# ` @ &@`@ `@@ݔ@@`@& ․`㿘 / T  XĔ  T?`8 - @ @ u/ . S 57`. P 1 . L1 . N81 . M. O7`. Q7`. R@s [ 7 .` 5.` 5`.` .` 4.` 4 .` 3`.` .` 2.`  2 .`  0.`  .`  7`.`  7 .`  5.` .` 5 .` 4.` 4 .` .`@5 \@X㿈@L @B㿈m@6 @֐, a "  " `" d h㾠 ``````, ,`-  '   ` ?@8$ ` `@6 (  2   -`0`  @6@- `0@(  3 @ @ @` $   Ը !  5  -   5   - + 5 -  -`  5`"-`?5` 5`-`  @ @ @7`/`7` @/`/`7` ?    5 -@5 ,-- @ 5 @4`,` 4` ,` ,` 4`@  ?  @ 4 ,  @4 -, , @4    @ 4,4 , ,@4  ? @  4, 4 /@,@, 4 @@5` -`5` -` 5` -`@ @?@   5 @ -  @5 ,@- - 5 @  5 - 5 - -5 ?@ @@ 7`@/` 7` ,/`@/`  7`  4 , @4 @, @,  4 @ ?@ @ 4` ,` 4` -@,`,` @4`@ 4, 4 @, @4 ,@ ?   4@, 4 -,@, 4@   5 - 5 -  - @5 @ @ ?$ @@ 5` -` 5` ,-`-` 5`@ @7`@/` 7` @/` @/` 7` @?( $@ 5-@5 ,-@- 5@ @4`@ ,`4` ,` 4`,`@  ?, (@ 4 ,  @4 -, , @4    4,@4 , , 4?0,@  4 , 4 /@,@, @ 4  @@1 @)  1  ) ?41 @0)     5@- 5 ,@-- 5   @ @@@0`@ (`@0` ?8(`0` 4(` 0(0 @(,( @  0 6@.6 . 6@.?<8@ @  5 - )5 @- @ 5 - @ 4`,` 4` ,` 4`@?@,` <@ (@ @@5`-`@5` @-` @5` @-`   ,4@ 4 ,4?D,@ @@@@@ 5 -.5 -5- @@ 4 , 4 @ ,4,@@ ?H, ,@D4  4 , 4 ,   @  @7`/`7`  ?L/` 7`H/` 5  - @ 5 @- ,-  5  @ 5` -` 5` -`@ 5`-`?P@L   @4` @,`,4` @,`4`,` @   5- @5 @-@5@-?T@ @P  4 ,/@4 ,4, @ 4  ,  4 ,  4  , ?X@T@ @ @ 4 ,-@4 @, 4, @@  5 @ -  5 - 5 @-  ?\ X  @@@7` /`-7` /`7` /`    @4`@,`@4` @,`@4` ,`@?`\ @  5` @-`,5` @-`5`@-`  4 , @4 @, 4@ ,@?d@`   5 --5 -5@- @   4, 4 ,4, ?h d@@ 4  , ,@4 @,  4  ,  @@7`@/` 7` /` 7`@ /`?l@h  @ 5 @- ,5 - 5 -  @ 5` -` 5` -`5`-`@?p l@ @4` @,`,4` @,`@4`@,`  @ 5- @5 @-5@ - ?tp@@  4 ,/@4 , 4 , @@4  ,  4 , @ 4 , ?xt   @4 ,-@4 @,4,    5 -  5 - 5 @-  ?|@ @x@ @7` /`-7` /`@7` /` @ @4`,`@4` @,` 4` ,`?|@@ @ 5`,-` @5` @-` 5`-` @ 4@ , @4 @,4@,?   5 ---5 @- 5    4,@@  ?4 ,4,4 , 4  , ,@, @ 4 @ @7` /` 7` /` 7`@ /`@?  @ @5 @- ,5 - 5 @-   @@ 5`-` 5` -`5`-`?  @@ 4` @,`,4` @,`@4`,`   @5- @5 @- 5@ -?    4 ,/@4 ,@ 4,   4  ,  4 ,  4 , @?  @ @4 ,-@4 @,@4@,   @ 5 -  5 - 5 @ - ? @@@ @ 7` /`-7` /`7`/`  @@@4` ,`@4` @,` 4` ,`?@   @ 5` @-`,5` @-`5`-`    4 , @4 @,4@, ? @  5 --5 -@5 -   4, 4 , 4 ,?@@   4  , ,@4 @, @4 , @@@ 7` /` 7` /` 7`@/`?   @5 @- ,5 - 5 -    @5`-` 5` -`@5`-`@ ?@@  4` @,`,4` @,` 4`@ ,` 5 - @5 @- 5@ -?@@ @ 4 ,/@4 ,4, @@ @ 4 ,  4 , 4 ,  ?  @@4 ,-@4 @,4 ,   5 @-  5 - @5 @ - ? @ @ 7` /`-7` /`@ 7`/` @ 4` ,`@4` @,` 4`,`@?@ @ @5`,-` @5` @-`5`@-` @ @ 4, @4 @,4@, ?Ĉ @ 5 --5 - 5-  @  4 ,@4 ?ȳ,4ě, 4  ,  4 , ,@, @4  @ 7` /` 7` /`7`@/`@?̔ @Ȅ@ @5 @- ,5 - 5 @-  @ @5`-` 5` -`5` -` ?Є̶@ @  4` @,`,4` @,` 4` ,` @ 5 - @5 @-@ 5@-?Ԙ А   4 ,/@4 ,4,     4 ,  4 , @4 , ?ؐ@ @Ԟ @ 4 ,-@4 @,4, @ 5  -  5 -  5 @ - ?ܞ@ض@ @ @@ 7` /`-7` /` 7`/` @@ @ 4`@ ,`@4` @,`4`,` ? ܆  @@5` @-`,5` @-`5` -`    4@, @4 @,@4@ ,@?   5 --5 -5@-  4 , 4 , 4 ,@?@   4  , ,@4 @, 4 @, @  @ 7`/` 7` /`7`@/` ? @@ @5 @- ,5 -  5  -  @@5`@-` 5` -` 5` -`?@  @ 4` @,`,4` @,`4`,`   5 - @5 @-5@-@? @ 4 ,/@4 ,@4@,  @ 4 ,  4 , 4  ,  ?@@ @ 4 ,-@4 @, 4 , @@5  -  5 - @ 5 @- ?    @@7` /`-7` /`7`/`   @ 4`,`@4` @,`4`,` @ @@ 5` @-`,5` @-`@5` @-`    @ @        @& @@& @@& & & & & & 㿠 ` `@& ` ? `& ` ` d& d# ` @ &@`@ `@@@@`@& ․`㿘 / ` dĔ  ` ? 8 .` `@ @ Ȓ/`. _ 6`4 . \@2`. Z2`. X82`. Y. [4 . ]4 . ^@  `6`.`5.`5 .`.` @x h8z|㿀@ 8df㿀@y 8NP" TH;j" X&.  0c" #" "  v" "  \㿀 #h  #t @1 #p ( #l````+``*`,@` `@@` . 6l) *  `@ ` -``  p (`0`(*  ` ,` @` 4`-` p ` `.6/ @) +  `7 `*``@`@- 5, + @*`4@`.`@`@ `(0- @+-5 @`,@`` `/ 7 /` @+`* 7`*``@`` ) 1 `, *`4@.,@`!` @`"@-` 5``#/ ,7 *`@(`@@`%@`$/` 7`)  `&1 @`'+`*`) @@@`)`( ( 0- `*5@`+,+ +`@/ 7 `- `.@/` 7``,/ `/@+`@/ @@@@`1,4`0@`2( @/ 0`3@/` @+ . -5`56`4@`6-/``7 /`@.6+` 3``8 `9+``:+``;+`@ . 6 + 3`=`<(`>`?(.`@@+3/ 7 @@ 7ᙲ@@.`6`@+` @3`@ @ @ @ @ .6@+ @3@ @.6/` 7`@@ @@.` 6`@+` @3`@  @@@@.` 6`/ 7 @@ @. 6/`  7`@@.6@+ @3 @@.`6`/ 7 @@ @ @@.`6`@+` @3`@ @ @ @@ . 6@+ @3@ @.6/` 7`@@@@.` 6`@+` @3`@  @@@ @.` 6`/ 7 @@.6/`  7`@ @@. 6@@.` 6`@ @ @@+` 3`+ @33@7z㡞@/` 7`. 67@ @.` 6`+` 3`@ 3@ @@.`6`/` 7`@7@@ @.6@+ @ 37@@.6@/ @7 3@@.` 6`/` 7`@7 @@@.` 6`+` 3`@ 3@@ @ .6@/ @7 3@ @.6@+ @37@ @.`6`+` 3`@ 3@ @@.` 6`/` 7`@7@@@.6@+ @ 37@@+`3` / 7 @3@@@@ .` 6`@/` @7`@3@@@@.`6`+ 3@6  +3+` 3`  7#ܚ@ @@ /` 7`@. @6@@@@@.` 6`@/ @7 @@ @@@.`6`+` 3`@ @ @ @@ .6@/` @7`@@.6+ 3 @@.`6`+` 3`@  @@ @@.` 6`@/ @7 @@@ .6+  3 @@. 6@/` @7`@@@@.`6`@/ @7 @@ @@@.`6`+` 3`@ @ @ @@ .6@/` @7`@@.6+ 3 @@.`6`+` 3` @  @@@ /`7`@@/ 7 @@ @@ . 6.` 6`7@ 5*TN@.` 6` /` 7`7@@+`3` / 7 @6@ .6.` 6`3@@@.` 6`@+ @ 3@6@@@@.`6`@@. 6@7@ @ .6/` 7`6@ . 6 .` 6`7@@@.` 6`@/ @7 @6@@@@.`6`@@. 6@3@@ . 6+` 3` 6@ . 6.` 6`3@@@.`6`@+ @ 3@6@@+` 3` . 67@@/ 7 /` 7`3@@.`6`#\+` 3`@ #d7\@@@.6@p@#x3(/ 7 #`t6c@@h+3t@ tl3+` @4@l@@.` 6`@p@,` 4`6@@p@.` 6`. 6@3@@@.` 6`+` 3`@ 3 @@@.` 6`@+ @3@7@@ @.`6`/  7 @4@@@@.`6`@,` @4`@6@@ @.`6`. 6@3@@@.`6`+` 3`@ 3 @@@.`6`@+ @3@7@@@.`6`/  7 @4@@@@.` 6`@,` @4`@6@@ @.`6`. 6@3@@@.`6`+` 3`@ 3 @@@.` 6`@+ @3@7@@ @.6/  7 @@3ta$@/ 7 @,` @4`@ @/ 7 . 6 @.6+` 3`  @@.6@+ @3@ . 6.  6@@.6@,` @4`@ @. 6/ 7  @. 6+` 3`  @@.6@+ @3@ .6.  6@@. 6@,` @4`@ @ .6/ 7  @ .6+` 3`  @@.6@+ @3@  . 6.  6@ @+` 3`,` @4`@3@@@3\b@,` 4`/ 7 @3 .6+` 3` 7  .6+ 36@. 6@/ @ 7 4@@.6@. @63@.6,` 4`3 .6+` 3` 7 .6+ 36@. 6@/ @ 7 4@@. 6@. @63@ .6,` 4`3  .6+` 3` 7 . 6+ 36@. 6@/ @ 7 4@ @.6@. @63@+3,` 4`@@ 3]b@@/ 7 @+` @3`  @@.6+ 3@ .6,`  4`@ @. 6@/ @7  @.6. 6@ @.6@+` @3`  @@.6+ 3@.6,`  4`@@.6@/ @7  @ . 6. 6@  @. 6@+` @3`  @@. 6+ 3@. 6,`  4`@@.6@/ @7  @.6. 6@ @,`4`+` @3`@ @@@  +`3`+ 3@@@@+`3`,` 4`@ @,` 4`*`  2`@ @@  .` 6`(  0@@  *` 2`,` 4`@@*2)  1 @@@/ 7 + @ 3@.6@ ,` 4` (0@/ 7 @ @ @ (` 0`. 6@@@+ 3 - @5  (0(` 0`  @,`4` * 2( 0@/ 7 @@  *` 2`  . @6  `,` 4`\& @ d( @ 0@@& @& x & @& 㿠 T T@& T ? T X & X#  @ c&@`@ @@@@@& L․㿘 / T Xǔ  T?`8   @ @V 0/  5-. L 2 . Q2 . P82 . R0`. M. S0`. N0`. O@;  .` 6.` 5.` 5 .` .` 4`.` 3.` 3 .` .` 2`.`   1 .`  0.`  .`  6.`  6.` 5.` .` 4.` 4`.` 3.`@ \@Z㿈@ @D㿈m@ @.]  K , K `  K ,`K   㿠C 㿠ސN ` 㿠@~Cf   @t@p 5 ,`% @  .@ O@@@O`ѐ.㿠@ C=㿠@J̸ C0㿠@A C#㿠P C㿠@? {C 㿠 #0 #0  @ܒ  ."*@฀`(97 `@’2``   @  ``-`'@. ``  㿠  Bf㿠  @ 2 㿠 2 㿠;c0 O /3-|c0   2  @m`(A= Aː  #\%#㨐@ c#hB  @  ##\#̖#i5  & +/sc   㿠 @#฀`735/ccุ  `2 @@p.@۔Aj `'/.@ײ 㿠  @Ԑ`` ``" @ `̐#\  @  `"Y 1k# @ (' A   #`  @  ",  ? #$2 \ @' `". @    $` $@`  `&$@א   `$@ @Ͱ ' 㿠#\l 㿠@L#\_ 㿠 #\S 㿠 $@@ `@㿠9  㿠.   ` `㿠 `@;  㿠 `@3  㿠 `%`@` vW&      $  㿠 ` %   vW@&    $ Ā   @ ̆#3㿠6`-è ?,4 @ ;+ * 5 c0)?/`@3`@ UU.`0@U @ * /`(07`^@ $?!#%>"  2 * ?1 .  `1 1  @ ?@@ * 0@0 0 @@@  @ 3 +  ?1 *` 1 1   ?@ @ + @00 0@ @ @ @ ^4p $?!#%>" ``3+ ?1 * `1 1  @ ?@@ +0@0 0 @ @ @@   2 *  ?1 +` 1 1   ?@ @* @ 00 0@ @@ @  4?5 `- ; ̷,2'UUUc3@'?+` 0` Æ (7 @ @,`3 ,+@0  ) && ̆#3㿠6`-è ?,4 @ ;+ * 5 c0)?/`@3`@ UU.`0@U @ * /`0(7`@$ ?!#%>"  *2 2  ?*` 2 @ ?2 @  @*1 @ 1  1  @ @ @    2*@2  ?*` 2 @2  @ ? @@* 1 @1  1 @  @  @  >$?!#%>"  3`+` 2  ?* 2 @ ?2 @  @ + 1 @ 1  `1   @@   2*@2  ?* 2 @2   ? @ * 1 1  1  @ @ @    @$?!#%>"```2`*` ?1 *  1 @1  ` `?@ *` 00 0 @  @  2*@ ?1 .  1 1 @  ?@  * 00 0 `@ @ @4 ^?!#%>p" @ *`2`2  ?+ 2 @ ` ?2 @ @*`1 @ 1  `1  `  @    6 . @2  ?+ 2 @2   ?@ @ . @ 1 1  1  `@ @ @    $?!#%>"@ * 2 2  ?.  `2  ?@2 @ `*1 @@ 1  1 @ @  @ @   2`*`@2  ?.  `2 2  ` ` ? @*` 1 1  `1  @ @   p $?!#%>" ``3`+`@ ?1 * `1 1  ` @?@ +0@0 0  @ @   2 *  ?1 +` 1 1   ?@ @* @ 00 0@ @@ @  4%UU5 U- ?,2@`@; ̙+` 0` c3 %?(7 @è @- @3 +.@0  ) &&㿠 #  , @ ,  /`@  .+ - 7 @733UU(`.,  5` @3 0 U ?* @7 ` ;?.6c , @62 .   `9+-#0b +?c 0(5 -@ 005(-0 @?`0`+ 0@ <0  0 ` 0*` *@000 `  8 ?+@55  <+  . 5  5@ 5  0  +@2 @* &`+`3` &`` 㿠& ?  a0    ` `@ `  `     㿠 א &   㿘 8`   /` *-` @  ) +(` E .``5,5 ,3,,2,2`,0,Τ㿐    -@ - , @'`    +  *`(@'@`   ,` @ - *` (+`@-`@ @.``4 - 2- 2`- - 0- 4`- 5- ʨ GD `   +  -*`  +   (+ @  ''.``5,3,4 ,,2,2 ,0,''æ/ 5/ 5 / 4/ / 6 / 6/ 4`/ 㿘    /` +`  -   * , (`@A|`R   -  )  *` +`@  *-' @'.``0`-`4-`3`-`-`2-`5-`1 -``ɔ?=`   + +   *`  ('@-`+  '.``0-0`-5`--3-4 -2-ɔ/ 2 / 2 / 2`/ 2`/ 2`/ 2 / / 㿘    /`-`,'    +` *)  9'`   +`   * ,   +)  *@ @.`5`,,5``,5`,4`,4`,4`,2/ 6/ 6 / 5/ / 5 / 4/ 4 / 㿘/ @-,@'+ ** @ $'`  /  + `@` - *  ,`@ *   @-.6`.0`.5..5`.4.4`.!㿠&! ` `! 㿠&! W` P` I @ @  q n!k  㿘!8`   /` *- @  ) +(` @ .``5,5`,3,,2,2`,0,Τ㿐    /`!-,'`    +` *)  '@`   ,  ( *@  (+- @ f.``3`-`3 -`2-`-`0-`5-`0-`ʪ`GD ` ` ` ` `+` `(`* ` `,`` )  +` )@ ''.``0`- 4`- 4 - - 2- 2`- 1 - ''è / 5/ 5`/ 4/ / 6`/ 6/ 4 / 㿘    /` +`  -   *!, (`@A|`̘   -) *`@'    +`  *- @'.``0`-`4-`3`-`-`2-`5-`1 -``ɔ?=`   + +   *`  ('@-`+  '.``0-0`-5`--3-4 -2-ɔ/ 2 / 2 / 2`/ 2`/ 2`/ 2 / / 㿘    /`-`,'    +` *)  9'` $  +`   * ,   +)  *@ @.`5`,,5``,5`,4`,4`,4`,2/ 6/ 6 / 5/ / 5 / 4/ 4 / 㿘/ @-,@'+ ** @ $'`  /  + `@` - *  ,`@ *  !@.6`.0`.5..5`.4.4`. @ 00c #0dc  h(`  l @ 1 1  c  1 c  @ (` @ @ @ 00c #0 c @ (`  @ @ @ 1 1 c #1  c  @ (` @ @ @ 00c #0 c @ (` @ @ @ 1 1 c #1  c  @ (` @ @ @ 00c #0 c @ (` @ @ @ 1 1 c #1  c  @ (`  @ @ @ 00c #0 c @ (`$ @ @ @ 1 1 c #1  c  @ (`( @ @ @ 00c #0 c @ (`, @ @ @ 1 1 c #1  c  @ (`0 @ @ @ 00c #0 c @ (`4 @ @ @ 1 1 c #1  c  @ (`8 @ @ @ 00c #0 c @ (`< @ @ @ 1 1 c #1  c  @ (` @ @,D @ " " D@ 00c #0dc  h(`@  l @ 1 1  c  1 c  @ (` <@ @ @ 00c #0 c @ (`8 @ @ @ 1 1 c #1  c  @ (`4 @ @ @ 00c #0 c @ (`0 @ @ @ 1 1 c #1  c  @ (`, @ @ @ 00c #0 c @ (`( @ @ @ 1 1 c #1  c  @ (`$ @ @ @ 00c #0 c @ (`  @ @ @ 1 1 c #1  c  @ (` @ @ @ 00c #0 c @ (` @ @ @ 1 1 c #1  c  @ (` @ @ @ 00c #0 c @ (` @ @ @ 1 1 c #1  c  @ (`  @ @ @ 00c #0 c @ (` @ @ @ 1 1 c #1  c  @ (` @ , @ " "㿘97!   ( -` $8 !  ᰠ`$  `   &  sU@#   &   rU"  & tW@$@@@ +@, * @ $  &@ -`p@U @-``?``    ɐ&& . 8 (`@&`&``.`L㿠;`H"J 㿘;`H :n`  (` /  +@ +` *` *@q0`.``5,`2`,`,`5 ,`3,`3 ,`,`Ϣ`6`  - - * *  ,(@@ 2`.``5`,`4,`,`3 ,`2,`1 ,`,`Ϣ`㿐   /` -`/``H@'    ++`*  '?`  - -   * *(`(@ @ސ2`.``3,3`,,2,1 ,5,,˦EB`  * * - -` ) + @  '0`'.``5,4 ,,3 ,2,2 ,,''Ĥ5/ 5 / 4/ / 6`/ 6/ 3/ / 㿘   /` * -` /` `H+ +` @z`F  - *` * ,, +`@ '  '2`.``0-`0`-`-`4-`4 -`3 -`-``ʖ?2`<`  , +  *   ((`@ '- @2  '.``0-0`--5 -4-4 --ʖ2`/ / 2`/ 2`/ 2/ 2/ 2/ / 㿘    /`-- @@'    +`+ *` 7'` ` `+` `+  `*` ` , `, ``+ @ 5 .` -5 `-5 -4-4-4--26/ 6`/ 7`/ / 5`/ 4/ 4`/ / 㿘/`/ -`@'++`*  #'`  +```/` /  + * , @@ %6.6 .7`..5.5 .4..㿠 @#  @ @ /@7@ 4  a4 4 @ # D #(` @   D@@*@ 2@ 7``7` H7`c@ *@'  H   ` &-500 c 0 #@ #.`@@  L% L @ *@ 2@ 7  7  7 @ *@ P#   P@ ` .6@7  7  c 7   #(`"  T@ T #@ * 2 7  7  7 c@ c*@@ X ! X@  .6@7  7  # 7  @- \ @ \ ` ) 17  7 c 7  @ c*`& `  `@ &@ .6 7  7   $7  c-@@ d&  d  ( 0@7  7 c (7  @ #*   h"@  h@ @` .6  7  7   ,7  #@c-`@@  l  l " ( 0@7  7   07  c@ )   p &@ p@ ` .6  7  7  c 47  #c+`@ t%@  t @ .@6@7  7   87  c@ (@&  x@ x@ % .6 @ 7  7  # |7  + @@&   < |  (0@6 66 c@ #*`@"&@&㿠 |# < | @ /@7@ 84  a4 4 @ # x #(` @   x@'@*@ 2@ 7``7` t7`c@ *@  t"  4 ` -500 c 00 #@ #.`@"@  p p @ *@ 2@ 7  7  ,7 @ *@ l#   l@  ` .6@7  7  c (7   #(`  h@& h @ * 2 7  7  $7 c@ c*@@& d  d@  .6@7  7  # 7  @- ` @ ` #` ) 17  7 c 7  @ c*` \  \@ @ .6 7  7   7  c-@@  X  X  ( 0@7  7 c 7  @ #*   T"@  T@  @` .6  7  7   7  #@c-`@@ P&  P  ( 0@7  7   7  c@ ) &  L @ L@ ` .6  7  7  c 7  #c+`@ H%@  H "@ .@6@7  7   7  c@ (@  D @ D@  .6 @ 7  7  # @7  +  @@    @  (0@6 66 c@ #*`@"&@&㿠 @#  @ @ /@7@ 4  a4 4 @ # D #(` @   D@@*@ 2@ 7``7` H7`c@ *@'  H   ` &-500 c 0 #@ #.`@@  L% L @ *@ 2@ 7  7  7 @ *@ P#   P@ ` .6@7  7  c 7   #(`"  T@ T #@ * 2 7  7  7 c@ c*@@ X ! X@  .6@7  7  # 7  @- \ @ \ ` ) 17  7 c 7  @ c*`& `  `@ &@ .6 7  7   $7  c-@@ d&  d  ( 0@7  7 c (7  @ #*   h"@  h@ @` .6  7  7   l7  #@c-`@@    , l$ ` 1) 6c@66 c c@*&"@&㿠 l# , l '@ /@7@ (4  a4 4 @ # h #(` @   h%@@*@ 2@ 7``7` d7`c@ *@'  d  $ ` -500 c 0 #@ #.`@@  `& ` %@ *@ 2@ 7  7  7 @ *@ \ "  \@ ` .6@7  7  c 7   #(`"  X@ X @ * 2 7  7  7 c@ c*@@ T"  T@   .6@7  7  # 7  @- P@& P ` ) 17  7 c 7  @ c*`& L  L@ @ .6 7  7   7  c-@@ H%  H " ( 0@7  7 c 7  @ #*   D@  D@ @` .6  7  7   @7  #@c-`@@     @ ` 1) 6c@66 c c@*#&@& ````- `-`,``.) `/`` `  ` *` + `,` ` (`) `*`5 @@`6 `a/ t5 |6 @/`x 5 - 6@c @-` @*@ 5` `5`5` - `#x-#\#l+ @+`.` @00 0 ``* #p(`#t@*`@-   , @  3  `3 *  `. (` 3 @.@  @4`#d #h4 , 4 `@& @+` `  @ & d-@ @ & hl(`\@  @& p  t@\2  2  `2 +` (,@ -@ @ @2 `2.` #@(`2` ) -`@@@ x@0`0* 0-` `.+`@@5`5`#| #.5@ ,@& |..`@& @` @@@& @ @@@@& @ @@4 `4, * 4 `-.`@@ @ 0``0`0` `* #*#) #-@@@  3  3  3  `- .`-@*@   3``3``# `#@-3` @* &  *@ .`@ @& $& (@ @ & , @  4 44+ `*#@.##*@*66 6 `*  ,@- @ @  5 5 +  *#5@``,@(`@  @4 4 `@@4@ `@  & 0 `  @ @& 4.`-`@@`*@ & 8+  `@ @ & < ` @4 4 `(#*@#`4#`@+  @*@  @00 0 +`#-#* * `  @@ 3  3 ` 3 +` @- (` @,@  @6`##6 `6 `@+`@ & @@ ` @  @`& D- -`@ @ `& H@(``@ @ @ `& L`2  2 +` `2 .` `+  ) @@ @ @ (`#̵222 * @`+`,@ @00 0 `,.`.+`@@5`5`#IJ #. 5@.`& P@- @.`@@ & T``@|x& Xt@@@ ̈`& \@`@@0``* 0`0` `. ./   `- 2`2`2` /``.@*  2 2 2/ `.- . 3 3 `3  `#К `##ؕ*@@г.`@@@`& `@Գ.`@@س.`@@@ `& d@ @ & h@ @@`& l@7``, 7`7``* `@@/ - @@ @6`(6@ 6@ * -@-@ 2 `) 22 `( ` .@(@  66 ``@6@ @ & p@* *@@ @@@& t*@@@  & x+ @@@ & | 㿐& `  @|Ք @|D ? 㿘 `:n`  ( ( - @ , *`@+  @|0.``0`, 2`, , 5, 5 , 3, , Ϡ 6`  /` /  +  * -` ) @@ݐ2`.``5, 5`, , 3, 3 , 2, , Ϡ 㿐   /` -`/`@'    ++`*  ' `?`  - -   +` + ( * @@2`.``7`,3,,3 ,2,5,,˦EB`  +` +  *` (` /`,`@ J '0 '.``0`,5,,4 ,3 ,2,,''Ĥ7`/ 5/ 5 / / 4`/ 6`/ 6/ / 㿘   /` * -` /` + +`  `@z`U  *` * * -`-  @+` ' '2`.``0`,5,,5 ,4 ,3 ,,ʖ?2`<`  , +  *   ((`@ '-2  '.``0,0`,,5,5 ,4 ,,ʖ2`/ / 2`/ 2`/ 2/ 2/ 2/ / 㿘    /`-- @@'    +`+ *` 7'` ` `+` `+  `*` ` , `, ``+ @ 5 .` -5 `-5 -4-4-4--26/ 6`/ 7`/ / 5`/ 4/ 4`/ / 㿘/`/ -`@'++`*  #'`  +```/` /  + * , @@ 46.6 .7`..5.5 .4..㿘 `:n`  ( ( - @ , *`@+  @,0.``0`, 2`, , 5, 5 , 3, , Ϡ 6`  /` /  +  * -` ) @@)2`.``5, 5`, , 3, 3 , 2, , Ϡ 㿐   /` -`/`@'    ++`*  ' `?`  - -   +` + ( * @@2`.``7`,3,,3 ,2,5,,˦EB`  +` +  *` (` /`,`@  '0 '.``0`,5,,4 ,3 ,2,,''Ĥ7`/ 5/ 5 / / 4`/ 6`/ 6/ / 㿘   /` * -` /` + +`  `@z`  *` * * -`-  @+` ' '2`.``0`,5,,5 ,4 ,3 ,,ʖ?2`<`ǐ  , +  *   ((`@ '-2  '.``0,0`,,5,5 ,4 ,,ʖ2`/ / 2`/ 2`/ 2/ 2/ 2/ / 㿘    /`-- @@'    +`+ *` 7'`` ` `+` `+  `*` ` , `, ``+ @ 5 .` -5 `-5 -4-4-4--26/ 6`/ 7`/ / 5`/ 4/ 4`/ / 㿘/`/ -`@'++`*  #'`  +```/` /  + * , @@ 6.6 .7`..5.5 .4..㿠 9#\;7`@  (4 [  &  & +      @` `@ ` ,+`  `    `  `   +@+ `  @*``  ` `!㿠 @wg! Ɓ   `2 +`a2`@ ``㿠 `  ;` a` ) `"  ` Δ!i [ɔ!i,`,`*  㿠 `  ;` b` / ` @ !i [!i,`* @/`@ 㿠 `  ;` a` / ` @ n!i [i!i,`,`/`@ 㿠 `  ;` b` ) [`!  ` >!i 9!i,`* @/`@ H;#\c  -@%#@v~ \`` '@в В `@vr 7``4 `' @#` !M `@  ``  ,   `% `  \ `$$D$o`$a ` @v#  @v `   *8)  8 .  * 쀈   `%Đڔ- Ȑ̐ .Ĕ@@\+ 3 /   "\( (0@#@Ú  @u  @u  @u  㿠   @     @4 4  #*4  4` h ` @(4` ?@ 4`#d   ((,  ,4@@ 7`/`  7``7` #-`7` 4 h 4 l ?( 4 c # @   ,`4`@@ @4 @,   @&` &` &`@&` 㿠  @  `  $@4`$4` #*4` 4  h  @(4  ?@ 4 #d   (/`,7`  @@7`4 #,`7`@ -`7`#4 ( 4 l ?( 4 # # ,`4`@@  % @@  4 ,  `@&` &`@ &` &` `㿐;` j-  ,`-- @@'    *@ * (@'   -@- +`@ '  *`(,`@'.`5 .`7`.`3 .`.`2`.`1 .`0.`.`7 .` 5.` 5 .` .` 3`.` 2.`2`.``f/  -`+* @ '    ) (`-@@'   ,+ @*` '  (--`@'Ζ.`3 .`2.`2 .`.`0.`7 .`5.`.`5 .` 3.` 3 .` .` 2`.` 1 .`0.``p Ф   /`-,'    +  *`(@'    -@+- `+` '    * ) (`'t `  ,*`) @'    +` ,*`'   (`+`,  '  ) (`+` '.``2 -1 -0--3-3 -4--2`-4 - 0- - 7`- 3`- 2-`  ** @ (@'    + **` '   (@-+ @ ' *`(/`@'ж '' ''''@''.``Г2-`Б4 -`Ї1 -`-`Ի0`-`ԛ3-`ԗ3 -`-`ؓ2-`ؑ4 -` ؇1 -` -` ܻ0`-` ܛ3-` ܗ3 -``/ 6`/ 6/ 4 / / 2`/  1 / 0/ / 5/ 5`/ 4/ / 6 / 6/ 3 / @rt  @rp 㿐    /`-`,'    +  *`(@'    -@- + '    *@ * (@^'-`   ++  *` .``5,5,5,    -`@+ *  ,7`,7`,7`,   -+`*  ,0`,0`, 0`, - @+* @ , 0, 0, 0,/ 6/ 6 / 5 / / 3/ 4 / 2/ /  2 / 0/ 0`/ / 5/ 6/ 6 / @q 㿐    /`-,'    +` *)  '    /`/-`ࠟ,'    +  *`(@'`q'` ` ` `-*`(@'.``3`- 2- 5-  ` ` ` `* ) (`@'- 2- 5- 2-  ` ` ` ` * (,@@ '- 5- 2- 2 - ` ` ` `(`@/`+` '- 2- 2 - 0-  |y)`O ` ` `++  *` .``@7`-4-@3 -' ` ` ` `* ) (`-3`-2-1 -' ` ` ` ` (@- + -@2 -0- @5 - ' ` ` ` `,`@+ *` - @7`- 4- @3 -'/ 6`/ 6/ 3/ / 3 / 2/  2 / / 0/ 7`/ 5/ / 4/ 6`/ 6/ @pd 㿐/ @-,@'+` *)  '   / @-,@'  +` *)  B'9` `` -,+ @  '    (@/ -@'   +  *`(@' -,+ @  'AŤ.6`.5.5..4.4`.3`..2.  2 . 0. . 7 . 6`.5.@o” 㿠@  &! 㿀 &    &   &  &!`%   @`  `  `  @*` *@` + $  s`& & & &  ap`"7`"mh  aH 7`/`  7``(` 7`@7`  ? `@``` %` %` %`%`` ݹ7`& h aH & 0(  7``( @7`7`   ```` `@` %` %`@%`  %`$%`(%`,` ׹0R& +h & & & aH 1 )   2 *` #22  @` `@` ` %` %`$%`(@%`,7``+ ` 7`7` #@@``` %`0 %`4%`8 %`<` ¹1 !B.` > ; 3ߺ`c   5 5 %,+`$ @ @22  ") (` @  6 @6  %@- +`$  5`@2`*`6 . @-`@@ $ ˠ  㿠 kap    `  4`t*`x7 6| 7 @ ` (@@64  c6 @ (` c4  4` #4 4`7  #. 5 c@?@  1  .   #@ c0 * 1 @ c0@ 1 0 5 *` @5 c@ (5@5 ?5  ?@  @  ,t4`x7  c6| 6 7  `*` c 4 c6?4  4  ) @ 7 c@ #4`4` ?@ #.@ 5 c?3` * #@ 0@ . 3` ?@ c0 `3` #05 *@ # @5 c@(55?5  @@     4`t.x7  6| #  `7 *@6 c@4 @  64  *  4 7 @ 4` c4` @. #@5  c?0`   .  c6 @ ? +`@ 0`6 @ #5@ 65`,`@5 c0` 55 ?.  4 @ 2@  )  @ 6 c  (26$# c7 @6 7  7  +` 2c@ c4 ( .4 # #@5  *@3`,@ 0 c # 6*`?3`64 #@5 6@ `) 55@ 58 #5@3` .  4  4`<  . @ #6@ @ ? + 4`@@6D  #7 @6 `*7 @ #7 @4 H4 4` ?@.# #5@  @0`L ) P  6  (@0`@ 6T #@ #5@6 ?@`*@ 5 #5@5X c50` .  @4  @@ 0\ *` c6 c *`0@6d @@ 7 @ 6 ?@+` 7 7 @@ 4 h#4 0  .# #5 @@2 @ l@ *p#6 c  . 2  6t #@@ c5 6@ ,` 5 c5 5x #5 2 ? . @ 4 @ ? 3 @|  +` #@ c 6) 3   6@ 3 #6 7  (` # 7  4 @.4 @ ?7  #5 @ ?@ *@01s!ptx c@6| 0@ *  @6@5 #@6  -`0 #@@55@. ?5 5  @@ &`@&`&`&` 㿠;oap/ - @`(@ *@d@  @ `h- @ `l P  `64. `87 @4<  4`(6c 7 @@4`4` 44`  `*@ @6 ?7 @.#   @@ `  *  20` #5 c ) @5@ 2#0` #5 ? `+` #52  #*@0`5 @5    '`  ` `,4687  c4< @ 4`) 6c@ 7 ` @4 4` . 7  c@ c6` @.#44`    `  @* 00` 5@ #? *@5@0 # #0`@ 5`)  #@5 0 ( 0`5 @5  @ '`  `64+``87  4< #? 4`*@6` c 7 @  4`4*  7 4@ 6` c4` @.#@   .  0``  5 6@ ? c +` 56  c0`@ 55`,@0` c5 65 ?.c@    ) 2 4`@@ #6@  `(7  6  #2@4` ?4` @ .  #7 @6 c27  . @ c@@? *0`5 ж #6?@ c *`5Ԥ6 c 0` 5 5` ) ؙ5@ 6 #0`@5  .c@   +` 4܄ 4`@ 6@ ? # `+ 7 İ6  #4@ 4`?4`@ * #ȅ7 @64 7  ?. @ c@ ?@ (0`̐ 5  c6 @ (5 6 c@ 0`5 ?5 ` +` 56 #0`@5 .c@    *`@44`@  6  # `* 7 6  #4@@ 4` 4`@  (#7 6@ 47  ? . @ c?@@ +  0`5 c6 *56 c@@ #0` 5 5`*` #56#0`@ @5 .c    @  (4@6 #4`#@  `. @7  6  4@@4`4`  + @6 7 ?. #@4 c 7 @?@ @ w p6 *4p8 #@0 5 #(5@*` #6 c0 t ?5) x@ @@ 6|@. 50 #55   @@@&`@&`&`&` !㿐!`i̤`  ) (`-@'    ,@+ *` '   (-- @@' +`* )  '.``5, 5`, 4, , 3`, 2, 2`, , 0, 0`, 5, , 5 , 7`, 3`,  e`  /`-,@'    *@ * (@'   -@- +` ' *`(/ @@'f.``5 , 3, 3 , , 2`, 1 , 0, , 5, 5, 5 , , 3`, 2, 2`,  㿐l'T%taH!H`yT  ,  - /  (  +` -`  * @(` +  * @ * , !@p(t(x(|(<(0(8(4(  $*`+ *   * ) @ +@     +- +`    )  /   * @  @   @ 1  #* @@5 2`   @  5 /`#@2` c2@ ? * 5  2`@ c `2 c1  ?@2*` 1 @ # ?@@  7`*#@32` c  ?3 `@ #-  2` # 2   +`2`2 ## `7` ?@  2 *` 7`3c   @  @ 1  /  @5 @# 2`@  ? + 5 @ #2`# 2 ?   5 @/  2` ` c2 c1   21  *`@ #@ ? @ `2 #+`3  c2`    +3 @2`# c7`   3 @2` `/  @7` 2@  7`@2@c*` @ ? @@   1 /  @5 #@ 2`@ ? @+ @5 @2`# c2   5 @ / 2` ` c2 c1   21  *`@ #@ ? @ `2 #+`@3  c1     + 3  1  c @7`@ @  3 @+`1  @7` @2  @7`2@c)   ? @@ 2` c/`2 #@1 ?@   `/ @ 2@ 1  #@ 5     $2 + 1 @ #5 # 2`?  (5 2`  #) @ c@  ,`2@ -  @3   1    0 +` 3  1  #7`@ ?@  43 @ *1  c7` c2  87`2 c) @  ? <@ 2`#/`@2 #@1  @  @@ `+ 2@ @1  # c5    D2@+ 1  @5  @2`  H@5 2`@ #)  c  L@`2@ c- @3  @1 ?  P / @ 3  1  @ 7`@    T3 @ *1 @ #7`# 2?  X7`2 c) @ @ ? \@ 2` /` 2 # 1  @  ` `+` 2@ 1  ##5  ?@  d2 + 1  c5  c2`  h5 2` #) @ c  l `2@#- @@3  @1    p@ + 3  @1   c7`@   t3 @@*1  @7` @2  x@7`2@c)   ? |@@ 2` c/`2 #@1 ?@   `/ @ 2@ 1  #@ 5    2+ 1 @ #5 #2`? 5 2` #) @ c@   `2@ - 3  2`  /` 3 2` #3`?@ 3  *2` `c3`3`c22   c*` @ ?@1  .`1 .`1 @ .`5 .`5 .`5 .`7 .`7 .`7 .`7`.` 7`.` 7`.` .` .` .`.``T1 1 . 1 T5 5 .`7 T7 7 , 7`T7`7`,T-`5 T-T(T(T* T*` T* T+ T+ T. T.`T,    ,@-(@@#d    * @*+ @ #`  ,@-(@@#\  * @*, :#h`(d(h(l(,( ((( $(( * *`@#l+ @ (   * *`@ + *@  ) * @ /   ``+ l*   @ d*+   h `l  @  / ` P ` +`2 @2` @1  @ @/ 2 #2@ 2`@?@ `@/ 1 #2`1 2 #2 2 ?* c # ?@  2*`#3#3` ?  `3 *`#@2 c3 ?@  / 3`@#33`@3 #3 @2 ?@@*  c ?@"  + 2 @2` @1  @ @/ 2 #2@ 2`@?@ `@/ 1 #2`1 2 #2 2 ?* c # ?@  2*`#3#3` ?  `3 *`#@2 c3 ?@  / 3`@#33`@3 #3 @2 ?@@*  c ?@"  +2@#2`# 1 ?  +`2  2@#2`@ @ `@+1 #2`1 2 #2 2 ?* c # ?@   *1 @#3# 3`?  `*`3  1 @ #3@ @ @*3`#33`3 #3 1  ?)   c ?@ +`1  @2 @2` @ `@/ 2 #1 @ 2@?@ @/ 2`#22`2 #2 1  ?)   c ? @   *`1  @3 @3` @ `@ / 3 #1 @ 3@ ?Ԓ@ @ / 3`#33`3 #3 1  ?ؔ)   c ?@ ܘ+`1  @2 @2` @ `@/ 2 #1 @ 2@?Ě@ @/ 2`#22`2 #2 1  ?Ȟ)   c ? @  ̐ *`1  @3 @3` @ `@ / 3 #1 @ 3@ ?@ @ / 3`#33`3 #3 1  ?)   c ?@ +`1  @2 @2` @ `@/ 2 #1 @ 2@?@ @/ 2`#22`2 #2 1  ?)   c ? @   *`1  @3 @3` @ `@ / 3 #1 @ 3@ ?@ @ / 3`#33`3 #3 1  ?)   c ?@ / 3`#2#2`? `2 +#3` 2? / 2`#22`2 #2 3` `?+` @ c@ ? @ @ +`2 #@7  #@@1  ?@p@@ @3 + #2@@ 7 @ ?t@ @* 1  #7 1 3 3  #2 ?x|*# # ?d  `@#`@ 2`2`2`\#\30lh#h3#d3.`0.`0.`1 .`1 .`1 .`.`.`.`.` .` .` .` .` .`.`Ӳ`Td, dT7`.dT7 .`dT6-T`-`T6`- `T6 +`T5+ T\*\T5`* \T5 * \T4( kT, hT4`, hT7`.hT6`-㿐    /`-`,'    +  *`(@'    -@- + '    *@ * (@['`   -`+`* @ .``0`,0`,0`,    -@- + @ @ ,0,0,0,   (`-+  ,2 ,2 , 2 , (@/`-` , 4 , 4 , 4 ,/ 6/ 6 / 5`/ / 4/ 3`/ 3 / / 2`/  1 / 0/ / 5/ 6/ 6 / @[ؔ 㿐    /`-,'    +` *)  '    /`-`,'    +  *`(@'!n`7   -+* @ '.``0,7`,4 ,    -`+`*  ',0`,5,5,   - @+ *` ',7`,4 , 5`, + ** @ @', 5, 5, 5 ,yv`˔   -`+`* @  .`` 0,@ 5,@ 5 ,'    +  *)  @,5,3,2,'   *`(/`@@,3`,2, 1 , ' (@-- @@, 2`, 0, @7`,'/ 6`/ 6/ 5`/ / 4/ 4 / 3 / / 2`/  1 / 0/ / 5/ 6`/ 6/ @Z 㿐/ @-,@'+` *)  '   / @-,@'  +` *)  ?'` ` ``` `/`- @+  ' ` ` ` `* (-@' ` ` ` ` ,@+ *` ' ` ` ` `/ -`,@ 'Ƣ`.6`.7 .7`..5 .4.3..2. 2`.  1 . . 0`. 6`.7 .@Y 㿠9x !p !p@Yђ  ."*`   ``& @  L; `'% #$pX`d   H F@Y H& & ; &   ;& ,& 0& 4  `-@* 8 5@  8 8`& D㿠   ``";  @ڐ  @p  ` F@Yj Hk㿀;xap ` 3x1ap! ` `@YA  } `9!tH  `?㿠  `  7#\5/(4!=  #\+)'`a@!T`!>  ``& D&`D& 3&  & & @X` ")-`" '- &@ލl)ފ!+-ކaԐރ & x& ;& 3`&  & @N"?- &@ߐ& & 'R,1O"`7L )G"+cCې㿠 ``c5 ` {  D M #\ D#@Lc,D!ɶ 31@/`?J #\ Dc`X!ʈ `?:#\c# D!1@ 7)#ڵ /-ڡ+ؖc !㏘ D` @ D& D' D  с㿠; `  3`)+#`c 2  @W(ϔ]  '! ( `ٺ a23/-㘺`a 2 @W` + ) 'ٲ 㿠/  @W"  ( (`a a@W"   㿠&/ H  @Wg ( `:  -' ' ) ' '  `"  `  `'     `' & !`G !@W`:n   -!& & ) &   ! @  T&  h   ` & `   & & &      `  ( '` `15 1'`-)%!'`"<'`$#`'` آ'`'`'``'`   @V   @V @Vΐ'` 㿠 㿠 ͐  &  & & &  ` "  ` "   ` &  Ő     㿠 `  `   ``    `     ` 㿠 ``  `  ƀ&     `@U & 㿠   w `r    @&  d ``_    @5    `-     `    tT$&   ,   `    &"  &r V "& @ %@@U& 㿠 `` 7  2    ) %  ` @`      -         @UW㿠 @  /`㿠 & @ &   @& ,@U  &       @       @U  @U @U `   6+   \*`  @ 㿠  `@`    `㿠  ` @       ŀ  `      @x  ` @       ŀ    `    @ؐ@T 㿠㿠ǁ㿠b 㿠] @TQ @ `@  @To`@@Tk ``@@ 6/``\/`@`㿠   @3 /㿠 i @$ @  \㿐 W @ @ J@T* 㿠ɐ˔́㿠ԁ㿠 㿠ƺ @Sْ @ `@  @S`@@S ``@@ 6/``\/`@`㿠  @݁ ٞ㿠 x @Δ @ʔ 㿠㿈 [ @ @ ސ@S 㿠߁   x!  ( "   x "@ 㿠    @ ` @S#`/     `     ``2 `  ` @ ` ) @ `  㿠  `  @R" @`    `@ "  ``  `""` "`  ""` "`   `"` "`    ``  `""` "`  ""` "`   `"` "`  㿠 `@3i @3N ' @3G㿐'@2 `@3<  `  ) `ט   /`̘  7  @5Ւ@2㿐''@2x`? @3    )!`   /`   7  |2 @5@2Q" "  "" `"   " "  "" `"   㿠 `\``` \ 㿠 ````  㿠'H'L'P'T'X  H L "`\"  ``x " `   T`xl'L'P'T'X@1@2@1 @2@1 @2x@1 ᔀ 8`3ᔤ  @Q    `& q@2-Q ,@1h  ' ' ' '   <  @@1VS < #@1 ?`"+ @1@1``͐) "   ` @1ː@1` L D@ /|$b0|O|` L$b`+`@              L`  @Q l M\``/O7@Q}(``\ @` }  D   D@`  @QNa,``' `@Q@  `D{0x  Dn  @ ' D `] &  @0U 㿠'H'L'P'T'X  H L B`"  ``Ҵ " `   Н 'H+H'LaX 'P'T'X; /`Ⱥ O J" b-@`` ` ```J ``@P_ `N"Y   *H-@P{\ `@Or :%   %  % @Pc` l "  " @PF`"   ːdǐa| Н 'H+H'La 'P'T'X; /ct @O J" b-@`` ` ```J ``@O_ `"Y   *H-@OВ `@Nǒ :%   %  % @O  "  " @O`"    āa| 㿐@.;xa _x`Z 7x `@/I ` <   2 @/# @/1  ' U @/ @/`A" @/.   @/#   @1@.c㿠  T :   @N ``T&` 㿠`P``` P'`0㿠 `X     '`  `X` '`   ``  ``€ `   ` 㿠   ː   @M ``&` 㿠5 `5  x  `x@& 㿘 `|   `|   '` '` '` '` '` 㿠 ` q   '`  `` '` `  `@ `  `@㿠 "  $"   @" #\  $@"  㿠 "  4`  `4"   㿠    @Q @a  ` 㿠 `  `  @4 @T@q        `` `    `` `` €    `` ``€    `` `` €    `` ``€ 㿠 "  "   @" #\  @"  㿠 "  ,`  `,"   㿠 "    "  @o @  @"  㿠  ' ` " @I @i@ @"  㿠 `"     "      `` ``€    `` `` € 㿠 `"     "   㿠 "  `\#\   "      `` `` € 㿘` "  " ` $`\`#\#``   $`"   㿘   (  @i  (ŀ#@  㿘 `   8  8@ۮ 㿠 \ `  @   @"  ŀ    㿠 \'  " `@   @   @   ŀ    㿠     `    ŀ 㿘     @  ŀ@& 㿘 `   0  0@{ 㿘 ` `  `@3   ƀ @>   ŀ/ƀʐ 㿘 `*  % `@   ƀ @    ƀ@0   ` ŀ{zƀ 㿘 `  `    ŀȐW ƀd 㿘 `  `  4@@ 㿘   `   x#\ 㿐` \` (` #\ ` ` (Ԑ#\#`@ 㿠  $('`'`'` E'`ΐ `3b@Ԓ  ;bl75P\  /ӯ  㿠 㿠  +bʵ "( ;/ʡb-␖  Nӏ   `2 '` '` ` ` ` Δ㿠 `5ʂ  ;pb97"̖ؐ  k]   㿠  3bf ;Tc$51#  u @` ` `@H`㿠 `54@  ;.c`97#DP     M㿠  6 $& & & & 3 cp ;c97#㌐  " "  " "   `   ?`2   `    @G `   @G 㿀@@@% @,i@@ @%Q@@ 㿈k @{@% @,Ɩp@y ' '`@%w@n x` `` ` 0 ` @@+Q6 2 $@)@'@%9% @+@%@#؁ @$Ւ@@: @Fΐ           㿀`` '` \#`Ð @Ӑ@$  @,Ɛ@ϐM@ː@+,﷐ ?Ā0 ŀ`쀤@@FY @F   䀦  {yw 㿠#\ 㿠#\w 㿀 `?-:(  ŀ@H@F@$XD @+ @D@B @#@;@9  㿈' '`  @@$, @+e @@ @    @쀥@E  㿘  ` @-ؒ   .' #\` @,  㿘   @-`   #\&` @-   㿠@  '@E@EG 㿠@ Ւ' '` '` 㿠 `  `?7  ŀF  @D&@@E:  㿠 `?  ŀ' @D&@@D  㿠' '`    ?  @ @D   㿠'  '` ŀ?켐 ` @@D Đ 㿠 `      $'` 㿠   3`@  㿠   3ؐ`t   `  㿠`` 5ɴ` 㿠 ``   ސ㿠   `ɐ㿠 ` `    ƀ㿠   ` ``     `2  `V㿠 ` `@C `L `- `@Cv L - 뿐 @C.㿘#\#`   @ 㿠\`J#H`@``8 ? & ,& (&  $ ,# & $ '   ' `8?2?& 8{?` 8x?`8u? /  (⸟ƀ ?&  #*%Hb-%(HH%S@@(,%D3 %P%,%$D% %L$$ `%, (  %0 ( $ %8 ( D  %<, b% (  %0- % "8 < `#bbb %,%% %|%-@n& @??㿠V?` QP?``*J`0`@-ɔ'`0 $$!$$&@0$@B0 &d&T` 0&@ @PL.@ @&@*  0@P L.@<@, &@@ + @8,`2 @<* 0`@ ?㿠*`&` "`$  ` '`'`'`'`,``%`%` *%```  q%`'`0%` @ $@ ?㿠:? 5 " ` 8/?8,?`|.`$@c*# , * `@X `|"'`'`|'`x'`'`'`'`t?  " 2`+   " )㿠 ` 8  #  `@A  & ` $   @#& &  " "`      &㿠? ``?    `  ` ?9"&   ' *' 4 ( |#`+ ! 8* 8  d* @ ` `W@@'@ q' 00`.&'@  @r d`   03 j 0?* e & 0 ` j   ?'   @ `%?&     -?&    l`B` >` | #*`" * @   "'  H F %`@  @a  `  D <- 4 D <$ +@@ݒ `?'  `    07??7` 0.ݐ'       2  ?'  b?& ?㿠"J?` "F?``* q?```$``(` <``$`(<@` 8``$`(8@` 0``$`(0@``$`('`q ?㿠~``z ` 4@ &   ( ?& +b@`&@&# (b $ &0 ( $ &8 ( DĀ &< (  0&`>8:<6 20`0$@@'/ 8`8$@@".<`<D@@.  `@@``bbb%t@& @&+ #@  &&&&( 0??㿠 @8`   %& `   0@*ޔ& 0 @?ڔ  & & 㿠 D% $  D < T- d h %& T!& d"@& h  #5% 8#``  %3`#`@ `) 0 d l @Ô l& l l  0 d d @ 0 P& @@  @ L,@ @ & @ l 㿠 ;?c&  '  l4y l`  l`% T `` 0 T T d`?%@ ː d & Td   `U  P   d l T & d& l d d  d  T& d$& l` 0 T@ T d%@  d & T1  "$  $ d T a   T   0 T  d T#@ y d & T   㿠;9/b7"द"""㤴    l!4 l`  l% T ` 0 T T d`?%@@ 8 d & T  `     l   0 d @ P L* < , @ & @ d. @ 8+  3 @ < d) 0@  $ d a#   `& X X` ~ d h+  X#@2 * &%0`"`.(  3!+`$*69  ((逆`6 l# X@  X `? x" & l@0 l  , X&& X d 0& d @ L d P@ d*  < , 8 @& @ *` @. 6 @ < d+3 X& X d`& d6 X d 0@& d& X 0 d d P@  L& @  @*  & @  d 0+@3 )  %*6 l ` d@ "& l`? & d  T 0 T T d# @ I d & T   㿘75#\#`☺b   ┬ ✴ l!O la`  lA `   0☦ d␂@ - 5* & +@  0& ` T ` 0 T@ T d`?!@  d & T ``       l`  0 d @ P  L+@ < ,@ & @ d +  @ 8*`@0 @ < d(2` X h& X& \& p( p x # $ d"! @ & X X  `  X \ d h" @ & X p  X p@ d l d p \""` `#@ * 0) 3 # `%) +  * @*3 @ !3d:  *`*)1) p#  l  p ` `?# & l! & p d`& d@ 0 d @@ P ` L* < , & @ d @+ @ 8-` 1  @ < d+ 2 p & p d& X& `& d  T` 0 T T d" @   d & T    ``9  0 d ?(3*`% +  0 `  T 0 T  T d#@ ؖ  d & Tq d l " & d& l   d l& ``& d#`& l㿠?`` ` '`'`'` 2 `&``"  ` @& ?㿠``$```@*`$``('` ?㿠WHN@R8P ? &  & (,&  $ ,c & $  ( & ? `$` $    $ &`   %  `  5F t/@@&u &? '`g ??    HTh㿘"? `"?  `? c #d ?#\  #` ?Т (    7 ` 8?(`    `" &  & &  ` !   & &     `0@   "\ & " #   Z     & & & `+ P @ 1 6+`#   "  & ! 2 ` ` ` `   "`  `"  d#    `  &{  & 2     $&  & &   *"` !  `2    & "&  & .  @'  $  2    `& #& `&  `,   % #      % &  & &     @ !  & 0 &   !# '`? & $ `@%k?   & #``"`   @$    "  " p   " & & & +  ` #  `[   "`&  & & +  @ " " C   "&  & & .  @#  " +   & # & &     `  `    # & #`y &  ???㿠-  ) `$ @#Δ 0 ? & 0 ,  ,%`&@  @(  & ?㿠M `I `    !     ?  `7\ @ @`  `    `   ` "& @& & $?     & & &` ?` ` ``@(>? `㿠 &+;x5x-x#a&+&+$)*t&+b&+( b&+0b 6&&@   3   )0```` *t1   2$" " " " 㿠9 H..kTJ P H/`.+T+X@  **`@ @ `(+@@  `   .` .@@ `) @@    $  $.,  ·.&kT㿠`+4 ` `` `` 5  ) L-T+  1 `b=3",`"kT**``@0*`  k4 6k4 "* @P @ & P &`b=ՆQ.&-4- k4`$" $* %@+4&`1+4 6k4#`0k4,".45` `,`+T#4`@$`*` &`&_@&2` `-`2`%) 0ݬ%㿀  --5 4 `  `  *` 6@6  㿠#\!`  H`"= L ` &&? P  H  `&*`"T.3 H @`# H"  P" ` &- `"T-7@ @ ("`& &&\"  P` & ..`#kT/ 7@ *"& \ H&4= e%.. P7  H@ L@ +X( $kT&+XJ.+X"&@ * "+T! &(`#T(@@  5`  @@ -/ 3 3`2 *&+X`2` L+4%`&+X-$T`\ `?   *  ?1 D  `@  "7@  )  *t+`0`@ 3*t  )  jt`2jt*`2* ` * 2* *`2*          ˆ 㿠`?     Ϻ 9 ""` `@" @?, tv  $ `(+6 6` $`( *2`$` ;. : 6@&``+ *2 6&n 8, v `@$t%(@-3` 6`(`$`2 )`$` >`.  :@ 6&%`t%`**`2 6@&* ` $*%(@ *`2 6`(`$`0 .``$` ; *   >@6& *.@-6@6&"%`- + 2@ 6`-2`$` (`$` >`.  :@ 6&۪ %`(@) 0@6&Ϊ ` g*  $*%(@(06`(`$`5 + `$` :`) `;6& *++`3  6& "%`- *`2 6`-2 `$` .`$` ;+  `86&s %`(@.`66 &f *  $*%(@.5@6`(` $`3` *@`$` 8.@ : 6@& ** *2`6&` "%` -(0@6`-0`$` +@` $` :*@ >@6& %` -@ +3` 6`&          `@;㿠 + ʐ)+ Ɛ+(a` `,*v '  #` /.&`@&㿠%` $&a,@/ 56 ,` 7 `& *   `& 9 ( =6&&a* *2`6`&` $&..,556  & *   & : (  ?6&. * 1 6`& $&,@-5`@6 ,` 7  & *@  `& 9 ( =@6&&,- 2 6`&A 9! ` & (jv--5`@6`-5` $` *@``$` 8(@ ;@6&   -jv+@+ 2@ 6 &Ȩ  &`) " ` #""* (3 @2 *  " (   " ;`+2 `;2?" ""* *0` 2" @㿠9"` " ""- + 46   & *  `& 8.@  =6&!""!-(`6`6`&!" $""a- *$ 2 6  `& (@  `& >. `= 6 &/"--`66&@ ""   ` h" !""-/`3` 6  & )  & 8`-@  =6& "" -(`6`@6 &"`$""$ -- + 2@ 6 4` `& (  & =. ;@6&""--56&@ "&㿠 |`   +@i+Đ+ʐbb  0 5` `> $ⴢ- -+3` 6 4 & *  & >`.  <6&ⴸ(@.`66 &ᬔ",@A $ⴢ/`/@ + 2@ 6 4  & (@  `& >- ;@6&ⴤ.-56`&+ + ` Y )@Iݐ@#  "" +`"2   +  * `0 !"""`` " * 0 (0 @("逘`2适""``?㿘;b; )%`"#`#)#\c`bbbb t)D  b@ :`*@  $"`* +2  6*`  *   ; * 2 ; 6 &**3 6 & + @ d  @$d"*@+`2 *`@6`  + ` ; +  2` ;@6@ & d*@+`2 @6 &3 `#" "*@+ 2@6*`   +@    :+@ 2` : 6 & &*@+`3 6 &&` *`2 *`   `$ "`*+`3 6* `  .    >+@ 2  ;@ 6 &  + * 3@6 &`4\  #" "`*+6 6*`  .   : . 2  ;6 & * *2 6 &@ db  %bdb((`7 6$` ( 4 & +@  `& ; *   8@6&dbb-@,3  6&db&    ` ` *    *@`1   8 *  2  +`"`` 3  " `" "  "  +@    "  :(2 "" "  "  *" 82  #`"  `  `"  (    "  :(@     " +@ 2 " 㿠ؐ9 "& .> 4`& ,;  ( 1 `& * >  `& (  `& - &  `% N`` -$` +`"    /  `2  `3`   㿠`  `  `.`'``<'`@/`'` `. </`  @ ;`d 5R0/-  ??   `Ȓ   ` 7` 㾠 @ m @ i;a81 )'%x#Lad  W    ! / -+a  X   `i `6u ]"  7` i  c   @  @  @ ;aՒ Ðb!ܖa  v  V  '%#P!b$"<  w  ? X -+)bl"  x  * `*(' `6`   6 ݐ"  7`    㿠6   & & /`. &  / @.  .`<. 㿠@Aց㿠 @/  `` @#` '`'`      `  *  `  "`    " " +`* " + @*  *<* 㿠m  ֐ & & /`. &  / @.  .`<.  `  `㿠C`5 `O```  @#` ' `.`@/ 㿠   3 & 2` : / (`@. b  '     6& 5>`  ,`, . 㿠t㿠oʁ㿠 `   7` -.`. 㿠   7`6`? ` - - `.  `  3` 2?㿠ْq`  UQ 6`Y /  ` (` ` @ !?       # `  .`&  `@" &  `  (@  "`&      +      7`6`? ` - - `. 㿠a```  6݁`@ & Ӓ`  ,`    % ` $   &@" &@&    (@  "`&      +      7`6`? ` - - `. 㿠M` 6 q @9/`  `- @%$&  `  (@  "`&      +      7`6`? ` - - `. 㿠z< u7  3` `4  4` `5 ? 5` `7`   ` `@" 6 `7  㿠8  7``?  @"㿠~`΁ȁ` `@ ` W`55`  ` ` `/`` ` ` @" ` +`" `& `&    2 6`?  @,-  @. ``  @"P  ` `@#   63` ;  (*` .   ` `@"  7 - - `. `& V``  @" ` ` @"  2 (`) @.   ` `@"   65` =  , ,` . `& ! ` ` @"E ` )  ``& `&   6`+  + ` .    (@  "`&      +      7`6`? ` - - `. 㿠a  `` ` 54 ` -  `02` ``    ```(` ` `/`` ` ` @! ` ,$@` & `&    6`0 `9 @.. . ``  @!( ` ` @!   54 `=  + + ` .   ` `@!  1 .(``. `& V``  @  ` ` @!  4 `+  + ` .   ` `@!   1 0`8`-. @. `& ! ` ` @! ` +# `& `&   6`- - `.    (@  "`&      +      7`6`? ` - - `. 㿠'L `L` %`5(T L` `@   ` )  ``& `&    5`4 < ` + +`` . 0`` @ LL ` `@    0.`/` .  L` `@     5 4` <  @*+  @. `&  `  (@? " &     +` `    7`6` >  ,-` . 㿠'Li``L``54P`` @LL ` `@ z    44  <`  *`* .  L` `@ d   0``. . . `&   L` `@  ` *! ` & `&   5` , , ` .  `  (@? " &     +` `    7`6` >  ,-` . xw`"q l`@ f `  `  @`  /`  @#\#`` ` @"B t 6`/`  `""`` 6` 6  ,`, .   @ϵ&  㿀Oi` `.iY ` @ p/   @;` ` @   p  / ?   "``"    6 5`= ` , , ` .   @@& 㿀` `  2  uM`@  ` `@   3`]5``А`+`{ . @@B- '@` `@;`@"V`@@ܔ &`@$ @K `@(` + @ ? '  `"  0`` @{` + @  ? "" &  @ @ ΂   7`6`>  @,-  @. 㿀a"] `X``1T ` `  5/` ג @`` @   @3&  `  +  $&      -@?` `/ @.  e㿀   ``L  @".` `  `  ̷/`  X `̪+` ͽ F `` @`-`&`@``@"eC  4 @͓&    (` ! &     +    `   7`6 >  @,-  @. T㿐Ґ` (' ``` @Ar ˒􀦠  `Ԕ 6㿠 `6`  `  -7@ 㿠6`֒`  , .@% @*& 㿐`@〦` ᰐ  [&` 5   0` "w 2 `+bn 4  2 bd #b!#Hː `  0. . .  A. ƒ9Β` `"``"``@"`a` V@ v V`v@"85 ?Q@@`$@`  $@`&`@ ` rS" r -% 耦`@ `ѐ4` ` -.   `  0`@" #. 0... x* ... 㿠@"X   K # % `(M "G9 -` 0" @>2  L @#  x ; b3L 7 @  ȴ # b@  @ "  "#V r@  R@ r@"  $ N@#` ` "N@  W    R `"  ڒ  K 㿐`  #@ Q2 ,2 ,2 ,,c$$``` ` @..Fz&` 㿠E     ` ` `/  `- - @@l`  [ 㿠 3bܐ@!f &.`5 ` /@!T`0`@!J`2  c @!@`3  23 c  @!4`   ?`   -`` &4%``@ ?. & 㿠7` G  ?   -@ `` &# %` &    /``  &  `   *@ ?    65`= ` , , ` . 㿠&$   5`  . . .  . `@2 `2 . 2 .  . .  㿠`     /`.-`4 @  `㿠ȑ   &  & & & & & & 㿠` ' $     `  $ ɇ    %` { `!`4` ` `'```` ` "` ``" ` ` & ``& ` ``"& ` ` `% `` `% ` `  ```'`㿠 2" & 㿠 `` m`㿠㿠'H @  ,H      HL    `HĀ { !        } H ŀ `  ` ƀ㿠@>`` `@i` ` ``  "` 㿠 `& ' &`' @' 㿠 `& ` ` & ` ' `' ' &` ' @'           㿠 @  X  &` d  N, { }"6 I   2b  $@&&6 &' &A`ɐ 2K 4G $@&& &$'` `21 "- ,*  &$@&``2 && `@   2 $@&  㿠` 5  `"  "  " " " 2'`  & "&     `       `2` 㿠X  ` @   @`" ` ` ` "  ``2   ``` `Ȕ`"  "   ` ` Z    㿠b "     = 㿐'H"   'mH@_`"-6 ``` @q```  `&`& ` ` `&` & `&  ` '`@-& @     @  [Y @RPx' .`2 ,: `J` `@`/`< @  @Ԑ  5@   א+@뀦 ` `` ``` ```` `9#@ 5@ @R@:㿀 &`   E5D`H   A `  Ht5$  +     cL ^     `;cPF&`ې㿐'LJH` `C> _DB@㿘 ` ! `V 㿘`   k 㿘@#cT "P )'#l%\d  "Ϙ  +c@))-֒ "1 31c/#  2  @ 5 " ;9`07 (  :   @"@㿘@#`H "P ;'``%PX  Os  @) }  /k-+`  XX @{ 1 @+֚3a]  9K!075 (  h8 @[ @W 㿠P> "x ah)!Xa`  |  o  "+ H5' +ҒX ' $  `@ ,< '%` @< m , Ւ  ;9a;a!   㿠“ há `Y`U   "!63`&@U' *  ` `  `@&`$@@'   ` `  @&& @+' \ ai 9!7U5Жؐ  C F B 㿠" d$4DT̒ %㿠 $   4 D T 힒 훒& 㿠 4G  A   $``}z '` 㿠 D # #``$`4`  `T㿠 $  < D 9 $ ' &`P줐젪Ц4윐옐얐Д WȔ OK@xB @nET0=ljhfdА2   ` @@p ':6  5Ԧ /5/5// @    @  @@ޔ   %@ @ ԙ5x \. $%    $ @  $ +?"@   @: ,`  `  t  `   . ` @F   Y     @.     @,  P . :\   &]  ؐ @ % ` آ `  * `ؐ    `@@-` ` @(>    € @' @@ ``@ `@ @$&$'` ` @В 㿐@9&` #` 5#\/#d଒  @%G"@ @ؐ"@ @%@ @㿀꿐є 캐  `5'`` W`e꬐ꪐ ꦐꤐ 㿀 5'`` ` ꀐ~ϔ ꀐ~ `.us 㿀 5'`` ` `62\ `B :8`J6`75 x /n 5  ’ܚ\Ҭ  ؀@(܁ @'`܁ x ΐ̐ޔCB Ð= 8 5 龐鼐<Zh鮐鬐 ܚؐr ܀`" ܁ 鐐鎐㿀 5'    S  +^ VT fR TR  JH  `3  ?@ :    `3 R?@ :    `3 `?@ :    `3 ? `3  ?@ :    `3  `3  `3  "`"     @ "         "" " 㿠Đ  㿠   @  㿠 ``  ``` r'`㿠 J " `" '` `  ``   `"    2 ?c q?#a* 8"`` `     @   @      @    @     @   @ ͈  ``` `"`@ ` `s S@ #` "`@ `2 r S@ "*@ 㿠 <&  `$`( ƀ   @  ( 8& & & & 0& 4 8@& <&`0㿠   (@ @   (ŀ%'`$  ( $    ('`(`$ $ (ƀ $ (@ `('`8'`'`, 44 | xDH 0 4  `` 0& 9? ,9?%; ###bl # ## # #|  #t c#l `#h #p#x G` +  ` %`   * ` & & ``%&`&`&`& 4@   & 2  2"544h% `3@& "@@ o@&  4& %& & ``% &`&`&`& 4@ ^?t4& %% & ! &`& & ``%&`&`&`& 4@ C? ` %`   *  `<& & ``%&` &`&`& 4@ #<0` @ &    & K  "F&  & B ;& `&`& & ``%&`&`&`& 4@?`o2Q  ,  ( 0@  ( 0 0 # , @8& 4@ϔ 0 4 0"" ,% , ( 0  ( 0  0#!  ,  & & ``%&`@&`&`& 4@  8@ %@' Ʈ%  "&  & & & ``%&`&`&`& 4@r` %`   + `l& & ``%&`@ &`&`& 4@Rl &  %1 `!` !`( ' ' p4& '%& & ``%&`@&`&`& 4@(? 7& &`& & ``&`%&`&`& 4@?  3  @ 4 ` %`   (@ `& & ``%&`&`&`& 4@` %4$`+ +`   2  р `` $`+  *"   ' x  $|@' &  `$`(  & & & ``%&`@&`&`& 4@  6 a ` %`   +  `*& & ``%&`&`&`& 4@u*  (` `` ``4 % $` .% S   ` `@  ` %`   +@ `4 & & ``%&`@&`&`& 4@64 %  *# 3@  2  @ `"` `(    & '   2  @!@ q`$;`(a4 ƀ & &`& & ``&`%&`&`& 4@?'   '' #\ $2 #d !#`@[䮐%@ & `(`$& ,& & ``%&`@&`&`& 4@? `$`( @ & & & ``%&`&`&`& 4@& & ``&`%&`&`& 4@   @ 0 4  `` 0&% ,"@  & & @a& 4@Z 0 4  0 , 0 4@& & ``%&`&`&`& 4@@ & & & ``% &` &`&`& 4@. & & ``%&`@&`&`& 4@?& & `&`%&``@&`& 4@?㿠 `$`( (@`$`( $@`$`( 㿠 (@ (@& 0& 4 ` `?㿠   (@ " * * " "  T < p㿘 0 4   `` 0''`  , $#d #` l #\     K଀ ;+  a . ,& & `&`&`% `&`& 4    @5 0 4  `` 0"# , @  2%  %  $ % %  %  +@@ (& &  ``%&`&`&`& 4@R(  @)   & `5@ % d% ` `% % `% `@ ` $+  % \% { % )!P&`& & `&`%&``&`& 4?@  %  .@ ) & &  ``%&`@&`&`& 4@)  & @ 5@ % $ % %  %  +@@ (& & ``%&`&` &`& 4@ˁ(  @ .   5@  & % $%  @2  $+  % #% al&`& & ?``%&`@&`&`& 4@  %  +@@ ) & & ``%&`&` &`& 4@~) & @ 5@$%  (    ( , (#   ``2N  , ` ( 0 ` ( 0  0# ` ,"`5& 4@F 0 4 0!" ,"@ , ` ( 0 ` ( 0 0 @#` ,"` & & ``%&`&`&`& 4@  `( ," ( # %  ``% W`2N  , ` ( 0` ( 0 0" `` ,"@`5& 4@ 0 4 0#" ,#@ ,` ( 0` ( 0 0""`` ,&` & & ``%&`&`&`& 4@  (%  `&%& 4@ 0 4  0 , 0 4@ & & ``% &`&`&`& 4@% & & &```&`%&` & 4@{& ?& ``%&`&`&`& 4@n& & ?``%&`&`&`& 4@a`$`( 㿠 0 4  @`` 0 @# .  ,. $/.`l %`  +@ *%` *    4 K"@(.  +  $  4,`"`ڀ! 2`# * @ ' % *`"' ``'`&'`'`' 4 `2a'`%*.' %" ' @``'` '`'`' 4?+`"   4 %`  *@ *%`@+    6@/$ @) .`@ *    3 $ @ `4'`"*(' %$' @``'`&'`'`' 4?   %`  .@ *%`+` (3 $ @ $@.$ ( , (#   ,#  ,`` (  ,``)! ,`,`` `,``! ,`,```,`` ! $  !4,`"` ` `2$ *+`' @ "' % ``'`&'`'`' 4 㾨#` ''İ''''''''''''''#\'T\`dh ,@+` # '`   `        < "'4@4  , * ,?  (- '?|#d Ė#'   $      d-*"&  4d/ @'|'@< #l@?#h*`$4 #x)  #p #tx  #|&,#@^d|&hl/  p&"# ` ,  x @&(````@% (`, @( `(`"`%`" /9/8 `4 @; >  '<`+` 8#@< '`4 &?&t/9  /8!4`  `* /8'<4`T" (\4P/8# *'< ,** 8"`<"` @ 3d/ , "   d'  &@"`,#` 2' |##|K@x4 #x$:x`4? 㿈'  (  ?#` #\  #d #hq?1!'  "7``7' ? ( $㿈d! '( `ŀ ?#d#\!#`!#h<<7#\. |#`#d#h\)  ! $(@ +bH$3bh$?7$?$("$#b($?($Ā|b" "`"" 㿠 0 4`  4% ,%`8`" ``"@&`&` 8` 8 <& <&`0@  , +@ , 4 (  (& 4 4`'@8``" ``%&`@&` 8 8 <& <&`0@ ˔@&` & 0 ?#@3`" ` `?@3` `"3`b ? 2 c  ?2  `# `?2  c c  V 2 2`" `" `" `" `" `" `  `! ! !  !   ` `!`" * `"*@"* @ `" @  "! !  ` `B` 2` ` 2`" " " " " " `   ``    `` ``" (` `" (`"(` "`"` """     Q" < "' 6  *`(`0"`"` *" 7+   *@`(`2"`"` (" %+  +```(`2 "`"` (" +  +` @`(0@ @"" *@" +  2   (   Q" <"'6  `` 3 (`#` `?3`"?6  `` 2+ #` `?3`"?$  `` 1 *@ #` `?0"?  ```@ 1(@ #` `?2"??`" 㿠.` ?T.`& ` `?`   @    @ *?  `@  @  `?+` ??`"``"  +`  (?  㿠` @$*  ! ` #` @ @ @,``@%`` `&㿠  @  @   $    - @@`$    -  '   㿠` '$8  ! ` % # ` @ @ @,``@%`` `&㿠  ` $  $ @`  "  - @@%`$     -  '   㿠? / /?? ` - 4   @T7`T@S#@ " /`7`@@4`#   @  ```%@ ܬ ` `` ː 㿠 * ;?6c%?@`` @U@2 QS@'@&+3@@4 # @ ` % - &㿠B./?.  ? - 7`@ T5`S@ U@$@ # , 4  @ 4 %@ @@     %  ܨ  `` ˔` .``*`2 %% *& 0 +?c #?V@0P@U'%+3@ % `` @ @ ` ``%`@@  %` ٪` * % % 㿠;|c6  / &`.`-@㿘#\|#` \`I 6`-- ,``&#d@ @  ) '@ , {)  ,  .d@+`Bdš "  .@  .&  "-`` "s  .  .  ?"  `" dd`d,  $@  , e "<  .  .@?'`` "\T\-&@@^\-&@@V  㿠9|# /|#@ +@7`'@6`'@&@ `  @ @`@ @@@ ٪@Ւђ p#t/|#d#p  +|c@ `\#h#x#|6,7`,t&'@p#l###` `@@@|x  x(`|"#x#| ,`F(` ,` --`- @ x|#`#\`"  x|#`#\tp`" ʐ `?  `"``"` #  `"tp &%`pc $@% @ x|#`#\4`"Q y .` .!  "dldh'd,h, &@ `2 >  dpt p t㿠.`7 ? 㿈2#\ `I'?\A .5 -  pW@ W@(`5`"@ @ @'`'`s@RR#@+`@&  /`" " %%̮%& &\,, \ &/`\??Ǡ. 4`#` @#l4" #h,#d?#t@9??l#p` ` @`tb`p@Qh5 @.`Q "  @ d !  ! sP# . hP #  ) @d   l@`R 6`pR  S@& *2@0"  8&``&` *"&8&``. 6`@\   @R@6 P@Q &#+3   2` & @* &  " ܖ@  %`\&`&% % %X& 㿠B .`;?7 / c?vW@W@`&-6 #   '`'`rP@P@`" *   /`@ ` `%%``̬%㿠8 .`;?6c.vWW &(0`%@@(@u@RR %@ -` " ``Ԩ% 㿐 #\ ?+?\`7 .c4, qPP! *`3` &@(uSS%-# Ԥ$&  &\, v\=\/ c,#h 4` @#d?#`.'?#l4% @? `?` ` `l_ pRR -0` #@  h ""rVV"@+ #@  *h&  & ` dR1 SV@ @ " *`2`@@ 0`"  @ 8!  !  *# "8!  . 1  \ @  V3PQ #&+3   6  "@ * "@   " ܖ %`\&% ^% 㿠ĺª! ` `  %  2 vW@&` &   `   `   , ` '`` ```   ``  ? ?    ``    `  ga& Ҙ  ɘ - @  @ #  -.ف㿠\$`Y 7 7? ?  ` 7 @V@6U@U##@* 2  @ 2S@R R' $,4 4 "   * ` &`  ܲ`@  , @ ``$@  `  ,``@'   `,``&`,` ? ,`%  `"Q   S `  S@ S@ `    `; "       ` 3%@  Ї@"XЀ @#:@#̒@&@#@#@"<Ч6  . )@""J @#X@#@#X@#X@&@#@#H@#FX@" ' i!Β  @! @"ɒ@' @#@#@"} @@!Œ @"@#9@'2@#j@"@"Xx l X@!@"@#ؐ@'p@"ڐ؁㿠 㿠@(o@'@"+㿠x@(_@"^ؒ@'@#$@"؁㿠 ( @'` 4 2'` ,4 d'`@  㿠   4 ` 4 ` @ǁ @ z @ zh\!  b" % #d#h#\#`@   " !~ c$ }@,#8 !j   %`" & 2 `"  `  '` 0"y  $ $ $$ ($ $ $ $ $ $ $ $ , $ `6 #\  ( ] ( P`L ܖ ( &G$ ' 51 $ $%  "& & 8 @  / 2  "    `2 㿠%=     @ & %  '  @f#\` Ӛ`&㿠5Ё @@ & @9#\  㿠% 9`` `(`'`@`'``````@'` ` `` `㿠Z!`8``4` 8O ` ` `(&E`*? ` `  *` ` (` &`&``#\````` `@| ` `8 ` `@``` @` &`&`` ` ``` `& 㿠  ` `: `@ 8?㿠 P p` =   4   `&$` $&   $ $$% %$$ $" %$,,&`(%$ ȶcH}j  !}X#dP#\ #RE `  ;/` -cx㠸 #U` h2 #\  㿠`  '` ` U'` `` @ `` ے㿠``   @5'     @'   ( #\      @^ 2  ` 7@ H  C+ 2< "8 ` `(`"- ( 2( (@ ! 2  (+`  `     2  +  ` `㿠\`dh    "M )G `6 #\*` `2#\% ` ! `#\q `` #\c` `2#\ " "`( " `&`㿠W & & `" `"  "   `     `  "   $`   $$`  "   `(`    ("   `,`    ,"    㿠 &`  &`  @v& 2   2 $  2 ,  2 (  #`#``,`㿠``   % `&`$`,&, `,㿠 ` `   `'`$ $  ` %`$&  ,%, `, `$'` '`$`$``$& &`$`,&, `,  㿠` ` `$& $`$` `$& o'`, 㿠   `(`(   &`$`& &`,` ` '`(`&`$&`,` `?  U㿠  &``   @o  & & 㿠Ւ 0 & ;& & & & & & & & & $& (& ,㿠 \ &` &  &` '  '` ` %"'`  `    㿠 &`&`&`&`\&``````@&` ` `@h&` ` ``&``@``#\````` `@  㿠 ? 0&`  `& `&$`(`%(``%```$``$```#`` # ``"``" ``! ` , 㿠````` ` / /  b   &  %`L " ,`` ` `&& ,  @ &`&` 㿠  &  %M@`m` ` ` '`a '`A``-`+`*'`0 `( &&  &` `)2M  &`  .&` ` (  &  "`I` )'`a '`A``-`+`*'`0  `- `+ `* $`&  `,  `.i  ` -@&`  &` h   ` ```" ` &` &`&`&`&` &`&`&`ȐȒ  ,@{ ,̐2Ȁ_Ȁ   ."{ @}%`  . @m/"b  -  -$@U"I  -ޒ  -$@@u"ȁ".  -Ò   %` - @ %`` - @   -  &`㿠7?<% )#=? ` `@&``!`&` `d`#&`M`k+ic *Ra0 $e2 p i2l8  uI`&``a&`:` &``!&`2` &``!&`*`&``&`"` @&``%&``@&`` &``@&``&` `2`&`Ji `4j  ,"'  @? , &&&`  `&`$ `&`     `` &`&` 㿠@ 9/!7t ?/M 5 @5 `@5.|M# R@"544 @ , @" *" *``" `@Ғ2 㿠7 & ??&` ?` ` ڒ ? ٘?'  ̘" 㿠 @ 0 @ 0& ,㿠 @  @ D<D`;#t /  #p  #x ?#- ;`    x# 8x  ` ` ` (  ` #x% $`x!9`d4" `! ! !  ! ", #|$(' ! $ (` ` `2 ' ! $! (&`,%`#, #|$(' &`$(`` `2' &`$" #\`#ĘԀ "ؐ`?y  &`&` |& | x `    (  "$ & $( ' $ (` ` `2 ' $ "   ` ڒ" ' (a   `   ` `f  t ` + @ #\ #`#d#h#l' `x#\ #`#d#h#l' `@ox#\ #`#d#h#l' `Yx#\ #`#d#h#l' `@Cx#\ #`#d#h#l' `-x '#\#`#d#h#l' `@x#h#\ #`#d#l `x2#x  `@&& 8 % `@``%`  ``$  `% p ' 㿠 & @t  @2-  ?ɒ&#& * &```&`@Y ,` ې   )$㿈'P 'T'X;c't /-t+` #`}'' ' )' @ , P'㿈'P'T'X;`8'tq +`h)t]' HX #}K Y&`2' ' ' )'  @ٔ ,N P`N'`` &U㿘 -  $  $ (````@` 4 $`* `3   `@@   E&'    tT|4L㿠 7i  N-@@  $``    $```   $ ``   $``@   $ ``   ` `@  p\ `' #| 3 #x?9#??#l#p#t ```  7" `"Ū퀧`  $ # ဧ`  |#` `#\  f#h #d   $! ǀ`ۤ €`   p` | #\  @#`  #h #d  x`" `` *` `    ` 2  `(2  #\#`  `  #`  U a`^` $ l"`  #\#`5  $ $#  2#\ $`21 "E ,`  $#&`  #`#\x   $ `t $"`` $ ! `2  ` '  "  L88(L㿐// 'B    6 0&$,&$(&$$ k <* &$&$&$&$ &$&$&(` `&& ``` "``  ``  `@a'#`  #\P  " @V㿈'P 'T'X;`'q /-q+` %Gz'' ' &' @/ , P`J'㿈'P 'T'X;`'q /-qq+a %fz_'' ' &' @ ,i P't㿠@C  @G㿠;@`;bԁ㿠;@`䀦` 7`#`bg_@@=?`%,+@ @`  @@ 뀧`5@㿠!z3`@a @`` @y!\@><%+`%@ - @ @h@d 怤;a@]Dxxxxxxxxxxx00xddxdxxxd㿈#\1쐐3/a,@4x@7@+458@%a@@LP@a@ @ !hl@@ጀ   5@  a@@ !@!#a@%1l%" / @@'@ΐ)@ɐ!6+@a)3@a!"-@@햐 p3㿠Z `'`yb㿠A  8 b؆ 0 ` d  0@#@ \ Z2 zည Q @* (`3 + @ \2 `P @ @ 5z2 Q @3 3 #@ + @) 2 \`P@+ ! *`+`  *$  8 *   Ȁ* * 8  \ ! Ȑ ȝh; 0c@'@+,9zcS+\V@44 +` *4  !`S@4  P@2" @&!nSm  4 !Q@00'/`, 4 `T@*%@ + +  $` &!n an&  !m!m am &!m9rq!̂  ̈@2`@ *% %&`.`. 4 `  ` `@ ?  `   `? `   ` @ ? `   ` ? `   ` @ ? `   ` ? `   `@ *?㿠 %   /  '@ .-%-`?`"+  +#@ * *`@G 㿠 7""" @ _@@T@3@ X@@V@> @ >  %-*6- :'@/ : _@@R@@"= =  ($+` @/ 2`'@ / `     S `" `*  ` * ` * ` * ` * `" `"  `*  `* 㿈 |+ & `. . . . & & . . . 㿀;  b Ԓ ]@;дct 0`&@놐$ #\#`#d"HȘ@죐 #`"h#\@앐  Ġ@]Ķ  L`@,``@R  '- @B'` * * 9333 ̀V@@1 1 .&@ `  @"  ̀V@44 +`&    +@ b  ̀U@00@/`%   @b  ̀R@44 +`"  ̀V@7`7`-` `: @˒"  8 5 *3 `8/ *+ 8'  *# `;8 *  ;8 Ȣ  & . . . . & . . . &   ;дc 0`& #/bgZ@:=`$++`" bg  ^ @:>" ((&bg  _@=? %,+' bg  ^ @:>" ((&bg [@=; %,+ "       `  #` #d #\#h   * [ @&`&`㿘 `;@ bB&`n"  " * * * * * " * *   `2 㿠N   L . `L ,/`` 3 7♪ %333 N@L``L`/ ͚+`# 0 W @2 `L` ` $N.` ׸    &`x V `C 79333 [    ̀Q@33  *! 0-`%`  ̀ '@  Ҁ 1 , 9" ϐ]    "3``2    3   3 㿠\ژ. . @.    . #'    `. 0``0`,` &7 " *`7  .'@  . 5`` 5` . % / 4.`% `4 .  `  ĉ8` "` 8` `"   # .@#   `   `` *`# ``    `  *` @#  `  `@  ` ` #`` "+  "#` ``  `"` ` (`@ "  `  ` #`"`  ( `#` # "`p#\#d#`#hc /2 @? 㿠"  ``   T OM  E`㿠;mb / " `" "" `"  " &   㿠h\ d`%  m$ @@ $'`   ` `* #\n㿐h\d`! Vg I  v $  5 $ $5`$$``@@ i$`@'`    -`& " * Ք I* $ 4 $`$`5$ϖ$``@ @ $`'` g  y`& %`+@@ N#\`㿠h\ld``5$$$`` @ Ր$`@ '`  `  `  (``  `@ϒ` ` ?, @ @*#\`p㿠h\ld`$?%  @@ $ @'` `@攔#\ A㿠\d`$%  @ c$ @'`  #\   # `㿘h\d`12  } $`   `$   3  $3    $``@ $`'` F   + `@ *@ ) /    `- ` ` 5``5`)  "@ `3"  ` *`` -@ ׄ #\` ` ` ` `hz\d `#\- #` #d 5S @2 2 "@(* (%| @J  "333 `̀R@4 4  @ * `̀R @3`R @22 (`D |e @$   `   `|V#X  -  +   |GL@$і$``@ $` '` `@&#\`Ӛh\\d ` `#\ ` #` ` #d` ` ` |  @ɐ$%   @$  '`  `@#\ 㿐h\d`_C Q4  $  2`$ $5$A$``@$`@'` ِ   -`& " ) EU $ 5`$`$`5$$``@ @I$`'`   `& $+@ y#\``   `2 " 㿐 `&   `     /@Ւ  ˔ 6 Ҕ 2 㿀   `&h  `  Д  /@  cD–^  ? ? &ݐ㿠&` &'  2!   &` *`@ %'  & o  & ' 㿠&'  ' O  &'  &'    "   " 㿠`       9,    gX@8`&` [@== ?@-`# &`)  `  )  `  `@ ) `  `) @$   & ͒  &      xŐ`  @⣔. @q '#`x#\'@バ `*ٰ ?@ 8Ұ &*̰ ` 8Ȱ .쀥*° 쀧 8 . 耠`* 耠8 .  * `<8 . *  <8 . . #c@9 " `.9#Ѐ)333㘔@( ~b@ b@ ̀P@0`& b@* * b@,+&` --@  Ob@K 2&'l&<c@ސ 4瀣+ &&瀤Z# %`)#@ǖ 耥`* 耥8 .*  <8 ...  xǐ` ;@ᥔ. @s #`#\ c''@⅐  * @ 8{ &*u  8q .쀤*k 쀥`8g . 耥*a 耦 8] . `*W <8S .  *M <8I * @. ?c@< 7瀣.4瀤`+ &&瀤Z#`% +c@" 耥* 耥8 . *  <8 ...G C 㿠;}bb`$L&   @@˔$L'$D&d@&$H@#㿠. $ fbc``.`. -`@@6`./`6`/`6`/`  ; `c  /+)b` '  k@@W& @g @ 1@ Lb`h;b֒9`T ` kĘ`@bВ b`  ࠐ kp@l @ @aȒz й/`Ԭ@. -`n @R8@O?<@cD^ H@Y L T P@ O XJ \E `@@d@; h6 lp@t@ ) x $ |Ē@  @  @ @@*  @ @ *  㿠$D``@ @ `  /``@'$D㿐$H`;`b  "''$H1-a 3̖`ؐ !rj '$H`a  a! !wjϘ  '$H   /` , -`@'   +` + * '   (` . /`@$@'    , ,+`  '@i @&    .** @ @@'5-5 -4--    +`+ * @'6 -5-5 --  ,`+.   '0-6 - 5- -   ,,+`   '1 - 0- 6 --  @ @&.`. -`@@'3 .2.2 ..((`-@@@'3.3 .2..   ) (. @@@'4.3. 3 . .   * *`(@@'5 . 4. 3..  @j '$D @'$@㿠1d !4@d @ ;cal@ &@㿠;}b` 9}" 7}@@$L5} &       (@  㿠  @-@`?㿠  @3-@`?㿠2&? @@֔ @& 㿠2&? @ݬ@ @& 㿠 <   '  㿠   ' "  ` 㿠#a_ " '5_Ր%  ^hØ  )@@+a_В "p /- _3a  eh $d ,  *, /  .&  & "@ #@  ` $  `#@"    `    @ &`R` & & ' & &  &  &    `%  `%'   k g `  $3`   㿠 ` @ ` @<  $.`& x`. $ $.x@. $㿠 ` `  @ с`  @E` ā㿠  `$ 7``     㿠  `$5   $6` `      t  p  0Ē @5 @+ X{ v   M  `F"`    & @В`b `& T5`& P P &  < 8 @\@>  T@~@N@ P@0А@_@В@ TΒ@? @   㿠b  &  㿠` @ې` `0`@  X@ۂ㿠d ` ` ` @ɐ`T``` @`` `T 㿠 @O ( $`& /`. $ $/ x. $t `` @``P@ 㿠U $`. $`$& x $+`x . $ @ ( $.. $ $-x. $` & ` `  @` ` ` `P@e S 㿠 @ `@f &   ( $/`. $ $/ x. $@݁㿠F` ` @`  @`㿠   @ `` @5㿠  @ `` @sف` lِ֐Ӻѐ+ ( ` ` @`  @ ``  Tf` `,` ` '` `Ty` Д 0`  @` @vr` `T^T` ` ђ }{㿠.) )#  `  @Ғ`   @3` ?P." ` ? 㿠   `  @   @7 ?." ` ?㿀Ԑ* @ ސ㿠!  @ `` `@Bˁ㿠  @ `` `@T㿠  @( `` `@\㿠  @ `` `@x㿠  @ `` @`_㿠z  @ `` `@ӔD㿠_  @ `` `@)㿠D    @ޒ  ``  @`  㿠      @Ғ  ``  @G`֐  0;cܲ &@ղ J  ǁ'$x Ј        .@, @. ;9aNK  ( `( `( \    ,' `=@ , 4"4` ɒ6``$2* @)  $ 5 +` +   '  $    `( ʐ)k2 fy(   زD?`;8   ϒ ύ8`/(&`~*  " ` "`Ԕ `Δ`ɔ`ՐC" d @P 5  _ XO  '``ԐҐP\dlx/S7଀0.@@ ԁxH؁xuؐcnk0ؐS 6M􀎠rx @c    Α;333 `̀V@5&  * Ƞ` (` ؐ b`(^  `P(`   &  ((` &       ( `3    @    /@#` @ 2 % /@&`@+ -  *`@. (@%( (-  - @ # ((  Ԓ ݸ (`` ԐՐ㿠 `    ɐ@  ()    @շP ӒK  A Ȑc  " '``   " ĐW  +`$# +`` `+`@ -@%`(@ `Đ Ub,ZbPZ0 `  ب  2Ô J’ @g5+" nl @   *`  `     2`* 2  㿠   7 & 6``>  ,-` .  "`  3  ) *` .     65>`  ,`, .  '  & 㿠㿠㿠]   5` ` 5`? 7`` `&   ̥ 7 `& 㿀) 0  ,Ȓ   ̘ ہ"  `F <  |B*  , , ʦ, ' ʟкD@`$и }# ˊ r& ` m&` 2` 2  .`(`.   ,` %`&     (```` * ?`#`&`` `` ,@?5` ``1 .(`.````5`4 < ` *+`  .`````3 2` : .(`.` `   7`6`>  @,-  @. |㿐R s–{㿀"< ݐ27  ` ɍ `/{2,   ɟ .& D  A"5|/5㿠̒ s㿠)6` %(  ` +@* "@    -`` &`&     /`㿠 `"`㿠&-  ? & - -,@@W$  |&F㿠 z  . & `` g `7   6 6` 0``0`za    $ @-`#4 ? . -` '@4 @ /``#  & 㿠??   2 ?  @  `@ *``  ``@ *@@ ??    7 -``- . 㿠6``m`   @h #@ ` .-&    ,  %`&      /`@   4`3` ;  ) *` .   - @%$&    (@  "`&      +    7`6` >  ,-` . 㿠 Ԓ    ,   %  `' 6`9?#!?@@@ R2 T  U""@* 2 `6@% @@= 㿐9{  s  k V Q  m'``8㿐& Q$E 63􀎠p/ɐŮÐ  |ؐ0qu֒    }{yӒ ͒ 䀤 %Ю4̔~䀧`АДifc<:86420`ŒSZ  m Ь ``  6>IJ4 45גܐڐؐ֐㿠K`  `>``  `   $`  `&    ) ` "&      , @?   7`6`? ` - - `. 㿠GX`4K`   `    @  @" ` ` ,    @%  &    ) ` "&      , @?   7`6`? ` - - `. 㿠X``ԐK`   `    @  @" ` ` ,    @%  &    ) ` "&      , @?   7`6`? ` - - `. 㿠XB`|<``   `  =%@` `&    ) ` "&      , @?   7`6`? ` - - `. 㿐   "?"&X *U .` .`.`.`  "  6`2`2`.``2`.`.`.`6i Ғ  "  7  5 ,5 .``5 .`.`.`[   ```.` `㿠`    -` .,@G  `  "  wF" `  ` `/` `za Uvl `  3`   㿠 `  wD .`& `@&  . &  .@. 㿠ܐ Ր `  7``ِ㿠ǐ  ` 7 Ő    7``  " " + *  *@* " 㿠:  u)/`&  ` & &    u/`&  &   & & `.  @.     .` ϒ'@&  㿠 㿠㿠F & & &  `. ` @ .@. `㿠-  v~ & & /`. &  / @. 㿠'A ````` . ```k&`7 ````͈㿠 '`g`` ` & 6`   7` ,> -` . 㿠Ð  '`  `&(㿠    @ݶ '@    `  `㿠 ` ` .`†``@'@㿠j+?e&? `" `  ` @ ,` `@ `@   `@@㿠9? `     `    2 .   /  `@́㿠?     @  `@ `  -`@㿠 `@8`@8 `& 㿠  `@8` `ï& 㿠 `@8`@8 `6& 㿠```/xʔY` `s.` #\#```{ x @1t.@` ?$ `@`&    &   O@s㿐`k㿀FO`,` ` r/`  |` `    *s`/`? `%``` ` `&   s㿠,6 2$`%@ 8`.* `#@$`$ $@%]㿠"6`@ $`&8  ,` ``@@& $㿀 ` &  ``  ` @`    `z8;.!.   "   n< plɐ̐ʐ p ``&  ``  `  `@  ` `/ `/ @  q.}b ?  } `  `  +} N bJ ? #ŐE.'.  גԒ4˒֐20.Z"&  g@    @`;c &@GͲ M'  Oвv `    .@p,  NK   2` ` X    -`' B -`` 5``"5``` y7``%`2*  %` 3+` ` '  R  %     5` qΐ*(  `  `3`  㿠 `  q .`& ``&  . &  .`. 㿠ؐ ѐ ` 7`ِ`    Β 㿠  `5   6` `        㿠 Ē n i @ $` `A: &  & & ``@ oP* &   H` -  & `& `    `   &    T n  d&  *&  `  o-&  &  /``/ &  o .&  `  p p p  㿠  $p p p @ƥ㿠` Ґy  `` T` &    7`6`? ` - - `. 㿠 & & /`.  / `. ` n-&  㿠ː  & &  . & ` ` ,``. & ` &  /`.  .`. ` ` n-&  㿠  p? & & /`. &  / `. 㿠`' `` `' 㿀qp w` &  `  @n:.]    ` ` `+   `   ,'  (``:`$    q    ` ,  @ &`"  f& o㿐`& Jy㿀 n` ` -m-] `  #\` ` ``` ` /   @ #  `" z! & n   7`6` >  ,-` . 㿠 ~  `` 㿐p jݐ㿠M`@ `` ` *` ` & `&       C&        `  -`` &`&     /`㿠K|`` ( ```&  f  *@ ? ^ #&  W  -   ``&  `  /  &  `   * ?        ` &    -`` &`&     /`xǔ`    ``  .` lI- l  `-  #\ #``` Q Hm=?` @" "  #\  `Q ` ,    %"  c & ` l& 㿀`V ` `` k/`   ```)`/` `&`"`   5`  .` " "  ` ܒ   ``/`? `%``"` Ҕ&    lk& 㿀`&   ` (`,``k*.M  -   ``p 6 El"?` @" "ʒ  #\  `6 ` ,    %"  H & `k㿀``&  = `  `j/ `ƒ  ``` `, $@````.@  $"  `` 8 .$@ `.`@? `"``"`  `    ג.@ ? @& "  & `@kH  ,?&    @`: `  :*"  `j/ ` (  `ϒ`-`@i` / @`  %`"   `      2  `P / @ ?  #``"  ( &   @j㿠ݒj``&           ,@@Q F  `     ` &          *"@   &   ݔ "   ,`2  %`&    .   㿀l <:S 4@97㿀J 1 @B㿀By 8  0 O  r'`ה`6 `;` &@גͲ ' в ȒŒ e`    .@h_,  ѐϐ~ِ֒   В` ` X    -`'  -`` 5``"5``` ɒ7``%`2*  %` 3+`  '   % ؒ    N` iYCA      ! p R  R  @  @     @    2"@㿠 9  ǒ#VT!M@$#6`5+ %@ - $ ,$@ + $ @ #'@   & #V@Sa@#@#1 6.%-- $,`'@#@@ #'@&  ? +` `S@(P@23 @* 㿠* @RaM@"@ 0`3`( *#(`#@( @ !M-`@"   `p P@ `@+` @ S@#20("(` * @( #S S@S@#0` 0( @* (`"(@#@2#" 0(#* @(#*-#@" @ R@"1 3`(#(!(`#@+ ""  ` -     qP@! "   Ra@"@ 02(#@+ (`"+`#@!pA@"   `p P@ `@+`S@#0` 0( @*(`"( @#S S@S@#20("(`* @(@#@"0`#"  0(#(` (#(`"pA៚#@" @ R@@"@1 2(#@+ ( @*#@"@ "   pA @   rP@" "  !#`"!!b  a!"!!!` `b + #`bﭕ+``; @3 +  !) 㿈ǐ  & b &!㿠&;bxCG   @ bC<!# &!!b  a!&!!! b .&b@.`;  `0` (`$@ !-`  ,7` 5  #`,`=?7נּ;2$/ !%&!!`b  a!&!!! b .&b@./   2 * $@!(- 5 # '%`-`ʀ}bB}b7}bN}b܂H  `` }b!}b܂@@} bܒ 8` v   )&#!RXK? V2N 2 `E $> 7 7$7  W*$ $ݒ-Ȓ` `ːɐǐŐ㿐  Ӑ   2I  )'< d 4``%`@ ` rV"",   `|  ~ z3 2   9 < " 8h @ # ` $! 'i    "      |  @    W2$$a@   @>"  @/D@=   "    uU@% @ 뀢   @Ɛ܀  ܮ @   /`@͐ @c{*  @ co  d@א    '`@  `&%`,@ @ )   $$$$@  Ҕ ٮ d̐dʐ1p   АN ͔4`u 6 `. 2  & 5P;` &   Аh Ɛ  ِ   Ԑ   А̒ Ȓ  `Ҕ `  +@  & :      } -  v . @qn@ jwʮ q4 753IB㿐;9 ?!` ;+! c某 Z@ : ߓ:"@ ) "'@`? )_@@@!^8`?`&@-'@ `-. _@@@ԥ?`<$@+ $ +#@ '@   Đ餒" Ő㿀鏒֐@ #\ڒ   8  Ц}z    " ?#p??`@ ?@ xI< oJZ y]`@ @5A&`  _˔  S̔Ĕ' \ߐP ɐ o Q  V ΐ IиӔ ؔ \ RڒFH O: C?*nlj  2 _0JGDкA><m\? 86 URa B?Ȕ0-Ib;(  ː   結ߐݐېِאՐӐ  ' "   " `   0+`0r @ 1 S@ +`    㿠.`ѐ.` @+ "    `4`  , @@#\\6,&\#\*\`@ `  ~  h    2     (   "  1 1 @  (` @ (  )  1 @ (` ` *`` 1    ( )  1   㿠 9#\;7bА@ "ܘ < `&`5 &  C&  -6&  ^Α.&    L  z&  㿠6`&  ^/ &    5  c&   ``x ` 㿠 _& 㿠㿠 zH  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ @ ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/>?456789:;<=  !"#$%&'()*+,-./0123 M M@ M$ M,3@h tD M< @h t0 MD @h t ML @, MT @,$ M` @,|j ggQR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqx Ml Mx1@0\$ M @0\ M @0\h M,,-. M ќ Mќ Mќ MDDDF M 4 M 4 N4 N4 N$"l"t#$` N4x@xHxHz N@ NH NP NT Nd Nl N| N N N N N N N N N N N O O O( O4 O@ OD OP OX Od Ol Ox O        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("("                              A@@A@@A@@@@A@@@@A@@@@@A@AA@@@@@@@@@@@@A@@@A@A@@@@AA@@A@@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                             $?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Phgvx8 5lCu7&HЋ0T#[=Y󮢂c.Q|륾 a:s,% NkSjEf̕VÎϿw93bqy $ŹMDpA{1' `\R_ I-O;GmF>id*/zKZ(?)3&_v*I!9ͭ1#N-HOex\XWgdc~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c         (08@P`p  0@`  0@`($(4(@(D(P(`(l(((0123456789abcdef  ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/>?456789:;<=  !"#$%&'()*+,-./0123      inflate 1.1.4 Copyright 1995-2002 Mark Adler  #+3;CScspp !1Aa  0@` ?? a4 a8 aL a` at a a a a a a a b b b b( b8 bL b` bt b b b b c c c  c( c0 c8 c@ cD@ cH cT c\ cd cp c c c c c c c c c c c c c d d d$ d4 dD dP d` dt d d d d d d;Zx0Nm f f f f f$ f( f, f0 f4 f8 f< f@ fD f f f f f f f f f f f f fX}.8%X}.8%X}.8% ח@`@@ @sftp_gdata != 0sftp2.cSftp2%s Warning: %s FATAL: %s Received signal %d.file1 != 0sftp2.cSftp2file2 != 0sftp2.cSftp2Sftp2sftp2.cSftp2Aborting the transfer...ssh_fsm_get_callback_flag(gdata->main_thread)sftp2.cSftp2 You have an active connection. Press again to terminate. Sftp2sftp2.cSftp2Connection ready.Local connection failed.Couldn't initialize SshReadLine. termcap entrys are probably wrong, or missing for your terminal type.ssh_fsm_get_callback_flag(thread)sftp2.cSftp2!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2Error: Not connected. Error: Local not connected (use lopen). lcdllsputmputlrenamelreadlinklsymlinklpwdlrmlmkdirlrmdirllsrootspreserve-attributesssh_fsm_get_callback_flag(thread)sftp2.cSftp2 Sftp2sftp2.cSftp2Got line: %s Error: Unterminated quotes cdlcdSftp2sftp2.cSftp2Command descriptor 0x%x (0x%x)Error: no debug level given. nodisable2Error: no hostname given. -lOpening a local connection Opening connection to %s Sftp2sftp2.cSftp2Closing active %s connection...Error: No directory given to command 'cd'. Error: No argument given. Warning: This command only takes one argument (rest are ignored). Error: No argument given to command 'mkdir'. Warning: This command only takes one argument (the rest are ignored). Error: Not enough arguments given to command 'rename'. Warning: This command only takes two arguments (the rest are ignored). Error: No enough arguments given to command 'readlink'. Warning: This command only takes one argument (the rest are ignored). Error: No enough arguments given to command 'symlink'. Warning: This command only takes two arguments (the rest are ignored). RlSr RlSr*nodisablep::W::c::Error: No arguments given to %s. Sftp2sftp2.cSftp2Adding %s to file list.h != 0sftp2.cSftp2-sNewline conventions: Actual: remote: newline@vandyke.com 0x%x local: newline@vandyke.com 0x%x Hints: remote: 0x%x local: 0x%x askIn batchmode, ignoring "ask" newline convention (using default value) askIn batchmode, ignoring "ask" newline convention (using default value) Newline conventions updated File transfer mode is now ascii File transfer mode is now binary File transfer mode is now auto Error: No argument given to command 'setext'. %s,%sAscii extensions are : %s Ascii extensions are : %s fs-roots@vandyke.comNo file system roots received from server. The %s filesystem has the following roots: lsrootsUnknown drive typeRemovableFixedRemoteCDROMRAM diskOtherUnknown type value%9s %s Unrecognized command line: '%s' Error: Could not read the batchfile. sftp> %s!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2sftp> ssh_fsm_get_callback_flag(thread)sftp2.cSftp2CD failed. Aborting batchmode. !(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2ssh_fsm_get_callback_flag(thread)sftp2.cSftp2PWD failed. %s !(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2ssh_fsm_get_callback_flag(thread)sftp2.cSftp2!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2Local connection failed. Connecting to %s failed. ssh_fsm_get_callback_flag(thread)sftp2.cSftp2Command failed. !(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2ssh_fsm_get_callback_flag(thread)sftp2.cSftp2Command failed. !(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2ssh_fsm_get_callback_flag(thread)sftp2.cSftp2Server does not have rename capability. Rename failed. !(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2Target already exists, operation aborted. ssh_fsm_get_callback_flag(thread)sftp2.cSftp2!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2ssh_fsm_get_callback_flag(thread)sftp2.cSftp2Sftp2sftp2.cSftp2Received error %d, msg "%s", lang_tag "%s"Server does not have readlink capability. Readlink failed. %s -> %s !(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2ssh_fsm_get_callback_flag(thread)sftp2.cSftp2Sftp2sftp2.cSftp2Received error %d, msg "%s", lang_tag "%s"Server does not have symlink capability. Symlink failed. !(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2ssh_fsm_get_callback_flag(thread)sftp2.cSftp2error message: "%s" %s !(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2ssh_fsm_get_callback_flag(thread)sftp2.cSftp2%s %02d:%02d:%02dSftp2sftp2.cSftp2ASCII transfer specified...!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2Sftp2sftp2.cSftp2Non-fatal error %d: msg: %sSftp2sftp2.cSftp2Operation complete.Sftp2sftp2.cSftp2No dir entries, pattern ``*'' returned no matches (error_msg = ``%s''error message: "%s" ssh_fsm_get_callback_flag(thread)sftp2.cSftp2Sftp2sftp2.cSftp2ls: starting glob.!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2Sftp2sftp2.cSftp2ls: starting recurse.!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2ssh_fc_progcb_screen_widthssh_fc_progcb_screen_heightct != 0sftp2.cSftp2namesftp2.cSftp2/@*filesftp2.cSftp2ct != 0sftp2.cSftp2Sftp2sftp2.cSftp2Dir has %d filesct != 0sftp2.cSftp2 Sftp2sftp2.cSftp2Waiting for parent to signal our condition variable...Sftp2sftp2.cSftp2step (thread: 0x%p) : Sftp2sftp2.cSftp2Dir has %d filestdata->child_cv != 0sftp2.cSftp2tdata->last_ct != 0sftp2.cSftp2 Couldn't stat file ``%s'', error msg: %s Couldn't stat file ``%s'' (%d) ssh_fsm_get_callback_flag(thread)sftp2.cSftp2!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2ssh_adt_num_objects(file_list) == 1sftp2.cSftp2h != 0sftp2.cSftp2*tdata->top_h != 0sftp2.cSftp2error message: "%s" ssh_fsm_get_callback_flag(thread)sftp2.cSftp2%s !(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2Sftp2sftp2.cSftp2We didn't receive file permissions from server. Bug in other end.Sftp2sftp2.cSftp2Pager Finishedssh_fsm_get_callback_flag(thread)sftp2.cSftp2Sftp2sftp2.cSftp2Asking the pager to finish.!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2Sftp2sftp2.cSftp2tab_compl: %sssh_fsm_get_callback_flag(thread)sftp2.cSftp2Sftp2sftp2.cSftp2constant part: %s, part to be completed: %sh != 0sftp2.cSftp2!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2%s/h != 0sftp2.cSftp2Sftp2sftp2.cSftp2added ``%s''path_list != 0sftp2.cSftp2h != 0sftp2.cSftp2h != 0sftp2.cSftp2 hlp2 != 0sftp2.cSftp2 Sftp2sftp2.cSftp2full_path: %s, word: %s, file: %sssh_adt_num_objects(gdata->file_list) == 1sftp2.cSftp2h != 0sftp2.cSftp2Sftp2sftp2.cSftp2String already had a '*' at end. Going directly to next phase.%s*Sftp2sftp2.cSftp2Trying with %s h != 0sftp2.cSftp2!(ssh_fsm_get_callback_flag(thread))sftp2.cSftp2ssh_adt_num_objects(gdata->file_list) == 1sftp2.cSftp2hlp2sftp2.cSftp2%s Sftp2sftp2.cSftp2prefix = %s%s %ssftp_gdata != 0sftp2.cSftp2Usage: sftp2 [-D debug_level_spec] [-B batchfile] [-S path] [-h] [-V] [-P port] [-b buffer_size] [-N max_requests] [-c cipher] [-m mac] [-4] [-6] [-o option_to_ssh2] [user@]host[#port] ctx != 0sftp2.cSftp2child process (%s) exited with code %d.Sftp2sftp2.cSftp2stream notification: %dSftp2sftp2.cSftp2read char: %c, read_bytes: %d, buf len: %dSftp2sftp2.cSftp2received message:Sftp2sftp2.cSftp2buffer: '%s'AUTHENTICATED YES Sftp2sftp2.cSftp2received message:ssh2 client failed to authenticate. (or you have too old ssh2 installed, check with ssh2 -V)EOF received from ssh2. Received corrupted (or wrong type of) data from ssh2-client.Sftp2sftp2.cSftp2Received SSH_STREAM_DISCONNECTED from wrapped stream.ssh2 client failed to authenticate. (or you have too old ssh2 installed, check with ssh2 -V)Sftp2sftp2.cSftp2Couldn't find ssh2 on path specified (%s). Trying default PATH...ssh2str != 0sftp2.cSftp2Too many arguments for %s (at least %d given).i < 64sftp2.cSftp2argv[%d] = %sssh_pipe_create_and_fork() failedExecuting ssh2 failed. Command:' %s' System error message: '%s' 0sftp2.cSftp2 Please answer "unix", "dos", or "mac" (without the quotes) :Specify %s newline type ("unix", "dos", or "mac"): fsm != 0sftp2.cSftp2/usr/pkg/bin/ssh2gdata->command_line_options != 0sftp2.cSftp2gdata->cl_file_list != 0sftp2.cSftp2--helpD:vS:Vh?B:b:N:P:c:m:o:642-b requires an argument greater than zero. -N requires an argument greater than zero. -%ch != 0sftp2.cSftp2h != 0sftp2.cSftp2D:vS:Vh?B:b:N:P:c:m:o:64Too many arguments. txt,htm*,pl,php* pathsftpcwd.cSftpCwdfile_clientsftpcwd.cSftpCwd//%s%s/%sSftpCwdsftpcwd.cSftpCwdPath OK: %spathsftpcwd.cSftpCwd/.hlp2[1] == '\0'sftpcwd.cSftpCwd%s/. Sorry, no help about topic '%s' available. %s: %s on %s %sSshAppCommonsshappcommon.cSshAppCommonAllocating global SshRegex context.SshAppCommonsshappcommon.cSshAppCommonFreeing global SshRegex context.ssh_app_log_severity: Unknown severity.ssh_app_log_facility: Unknown facility (%d).glob_string != 0sshglob.cSshGlobstring != 0sshglob.cSshGlobSshGlobsshglob.cSshGlobMatching "%s" with "%s".0sshglob.cSshGlobstr != 0sshglob.cSshGlob*?[](|)#*?[](|)#ch != 0sshglob.cSshGlobstring != 0sshglob.cSshGlobSshFileCopysshfilecopy.cSshFileCopyAllocating SshFileCopyFile structure...file != 0sshfilecopy.cSshFileCopySshFileCopysshfilecopy.cSshFileCopyDestroying SshFileCopyFile structure...SshFileCopysshfilecopy.cSshFileCopyClosing file-handle...file != 0sshfilecopy.cSshFileCopyfile != 0sshfilecopy.cSshFileCopyfile != 0sshfilecopy.cSshFileCopyfilesshfilecopy.cSshFileCopytrav_cb != 0sshfilecopy.cSshFileCopyfile->dir_entriessshfilecopy.cSshFileCopyfile != 0sshfilecopy.cSshFileCopydir_entry != 0sshfilecopy.cSshFileCopyh != 0sshfilecopy.cSshFileCopyfile != 0sshfilecopy.cSshFileCopyfile != 0sshfilecopy.cSshFileCopyfile != 0sshfilecopy.cSshFileCopyfile != 0sshfilecopy.cSshFileCopyfile != 0sshfilecopy.cSshFileCopyfile != 0sshfilecopy.cSshFileCopyfile1 != 0sshfilecopy.cSshFileCopyfile2 != 0sshfilecopy.cSshFileCopyfile_listsshfilecopy.cSshFileCopySshFileCopysshfilecopy.cSshFileCopycur full path: %s/%s/%s/%sSshFileCopysshfilecopy.cSshFileCopyfull_path now: %s (cur parent: %s)SshFileCopysshfilecopy.cSshFileCopyfull path: %sSshFileCopysshfilecopy.cSshFileCopyAllocating SshFileCopyConnection structure...SshFileCopysshfilecopy.cSshFileCopyDestroying SshFileCopyConnection structure...conn1 != 0sshfilecopy.cSshFileCopyconn2 != 0sshfilecopy.cSshFileCopyfilename != 0sshfilecopy.cSshFileCopyfilename != 0sshfilecopy.cSshFileCopyfilename != 0sshfilecopy.cSshFileCopy.././../..SshFileCopysshfilecopy.cSshFileCopyConnection to %s%s%s, ready to serve requests.SshFileCopysshfilecopy.cSshFileCopyConnection failed.connection != 0sshfilecopy.cSshFileCopycompletion_cb != 0sshfilecopy.cSshFileCopySshFileCopysshfilecopy.cSshFileCopyMaking local connection.SshFileCopysshfilecopy.cSshFileCopyConnecting to remote host. (host = %s, user = %s, port = %s)connect_callback != 0sshfilecopy.cSshFileCopydos mac unix Ignoring unknown newline convention '%s'ssh_fc_progcb_screen_widthssh_fc_progcb_screen_widthssh_fc_progcb_screen_heightssh_fc_progcb_screen_heightssh_fc_progcb_prev_screen_widthssh_fc_progcb_prev_screen_widthssh_fc_progcb_format_stringssh_fc_progcb_format_stringattrs != 0sshfilecopy.cSshFileCopyattrs->flags & 0x00000001sshfilecopy.cSshFileCopy %s: complete md5 match -> transfer skipped ssh_fc_progcb_screen_widthssh_fc_progcb_screen_widthssh_fc_progcb_screen_widthssh_fc_progcb_format_stringssh_fc_progcb_prev_screen_widthssh_fc_progcb_format_stringssh_fc_progcb_prev_screen_widthssh_fc_progcb_screen_widthssh_fc_progcb_prev_screen_widthssh_fc_progcb_screen_widthssh_fc_progcb_format_string %%-%d.%ds | %%4sB | %%4sB/s | %%3.3s: %%s | %%3d%%%%strlen(file_name) - name_space + 2 > 0sshfilecopy.cSshFileCopyname_space > 3sshfilecopy.cSshFileCopy..%sssh_fc_progcb_format_string thread_data != 0sshfc_glob.cSshFCGlobSshFCGlobsshfc_glob.cSshFCGlobDestroying thread data...SshFCGlobsshfc_glob.cSshFCGlobGot file %s.%s/SshFCGlobsshfc_glob.cSshFCGlobAccepting file ``%s''.file != 0sshfc_glob.cSshFCGlobh2 != 0sshfc_glob.cSshFCGlobNo match (pattern ``%s'')Got NO_MATCH from recurse. (this is a bug.)ssh_fsm_get_callback_flag(thread)sshfc_glob.cSshFCGlobSshFCGlobsshfc_glob.cSshFCGlobFile list is at it's end.orig_filenamesshfc_glob.cSshFCGlobSshFCGlobsshfc_glob.cSshFCGloborig_filename = %s/SshFCGlobsshfc_glob.cSshFCGlobAdding file %s to file list without globbing...SshFCGlobsshfc_glob.cSshFCGlobbasedir: %s, file: %s.h != 0sshfc_glob.cSshFCGlob../%sPattern ``%s'' was deemed invalid by the sshregex-library.SshFCGlobsshfc_glob.cSshFCGlobStarting glob of %s...SshFCGlobsshfc_glob.cSshFCGlobbasedir: %s!(ssh_fsm_get_callback_flag(thread))sshfc_glob.cSshFCGlobGlobbing successful.No matches.SshFCGlobsshfc_glob.cSshFCGlobDestroying global data...connection != 0sshfc_glob.cSshFCGlobready_cb != 0sshfc_glob.cSshFCGloberror_callback != 0sshfc_glob.cSshFCGlobSshFCGlobsshfc_glob.cSshFCGlobStarting globbing, file_list has %ld entries.glob_context->fsm != 0sshfc_glob.cSshFCGlobglob_context->main_thread != 0sshfc_glob.cSshFCGlobtdata->regex_context != 0sshfc_glob.cSshFCGlobmain_threadthread != 0sshfc_transfer.cSshFCTransfergdata != 0sshfc_transfer.cSshFCTransfertdata != 0sshfc_transfer.cSshFCTransferfile != 0sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferReceived error %s%s%s%d%s.%s (%s): OK %s%s%s%s (%s): received EOF %s%s%s%s (%s): no such file %s%s%s%s (%s): permission denied %s%s%s%s (%s): unspecified failure %s%s%s%s (%s): operation unsupported %s%s%stdata->status_cb != 0sshfc_transfer.cSshFCTransfertdata->handle_cb != 0sshfc_transfer.cSshFCTransfertdata->data_cb != 0sshfc_transfer.cSshFCTransfertdata->name_cb != 0sshfc_transfer.cSshFCTransfertdata->attrs_cb != 0sshfc_transfer.cSshFCTransferfct_transfer_callback: Got SSH_FX_NO_CONNECTION, even though we wait for the version. (this is a bug)%s (%s): connection lost%s (%s): bad message%s (%s): out of memoryssh_fsm_get_callback_flag(thread)sshfc_transfer.cSshFCTransfertdata != 0sshfc_transfer.cSshFCTransfertdata != 0sshfc_transfer.cSshFCTransferssh_fsm_get_callback_flag(thread)sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferSource connection OK.SshFCTransfersshfc_transfer.cSshFCTransferEstablishing source connection.!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferDestination connection OK.SshFCTransfersshfc_transfer.cSshFCTransferEstablishing destination connection.!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferFething source newline convention extension data.newline@vandyke.comSshFCTransfersshfc_transfer.cSshFCTransferSource sftp-server didn't give newline convention.SshFCTransfersshfc_transfer.cSshFCTransferFething dest newline convention extension data.newline@vandyke.comSshFCTransfersshfc_transfer.cSshFCTransferDestination sftp-server didn't give newline convention.Connecting to source failed.Connecting to destination failed.SshFCTransfersshfc_transfer.cSshFCTransferStatting destination location ``%s'' before transfer...!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferdestination (%s) is not a directory.SshFCTransfersshfc_transfer.cSshFCTransferSetting next source file item...tdata->child != 0sshfc_transfer.cSshFCTransferct_ctx->cur_loc != 0sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferNo more source files in this list.0sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferfile name: ``%s''SshFCTransfersshfc_transfer.cSshFCTransferfile ``%s'' doesn't have dir entries/.file_name != 0sshfc_transfer.cSshFCTransferh != 0sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferbasedir = %stdata->child != 0sshfc_transfer.cSshFCTransferct_ctx->cur_loc != 0sshfc_transfer.cSshFCTransfertdata->child != 0sshfc_transfer.cSshFCTransfertdata->basedir[0] != '\0'sshfc_transfer.cSshFCTransfer//%s%s%s/SshFCTransfersshfc_transfer.cSshFCTransferdestination file: %sSshFCTransfersshfc_transfer.cSshFCTransfersource file: %sSshFCTransfersshfc_transfer.cSshFCTransferFile server didn't give us all attributes for file ``%s'', trying to continue without them.File ``%s'' is a directory, and directory creation (recursion) has not been enabled. tdata->cur_loc->dir_entries == 0sshfc_transfer.cSshFCTransferFile ``%s'' not a regular file, directory or symlink.tdata->after_stat_state != 0sshfc_transfer.cSshFCTransferstat: %sstat: %sSshFCTransfersshfc_transfer.cSshFCTransferStatting source file ``%s''...!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferStatting destination file ``%s''...!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferstat_after: %sSshFCTransfersshfc_transfer.cSshFCTransferStatting destination file ``%s'' again...!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferSuccessfully created directory %s.SshFCTransfersshfc_transfer.cSshFCTransferDestination directory ``%s'' already existed.mkdir: %s!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransfertdata->child != 0sshfc_transfer.cSshFCTransferchmod_dest_dir: %s!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferSuccessfully removed source directory ``%s''rm_src_dir: %s!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferthreadsshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferGot result for overwrite: %s.SshFCTransfersshfc_transfer.cSshFCTransferThis file should not be overwritten. Skipping.ssh_fsm_get_callback_flag(thread)sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferQuerying overwrite (dest file: '%s')...!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferopen: %ssrc_attrssshfc_transfer.cSshFCTransfer!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferFile `%s' opened successfully.open: %sSshFCTransfersshfc_transfer.cSshFCTransferOpening dest file %s...!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferOpening source file %s...!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferchmod_dest_before_transfer: %sdest_attrs != 0sshfc_transfer.cSshFCTransfersrc_attrs != 0sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferDestination file is not a regular file, not changing attributes.SshFCTransfersshfc_transfer.cSshFCTransferSetting permissions.!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransfertdata->child != 0sshfc_transfer.cSshFCTransferdest_attrs != 0sshfc_transfer.cSshFCTransfersrc_attrs != 0sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferDestination file is not a regular file, not changing attributes.SshFCTransfersshfc_transfer.cSshFCTransferSource file attributes do not contain times and dest file attrs don't contain size, skipping.SshFCTransfersshfc_transfer.cSshFCTransferSetting modification time.SshFCTransfersshfc_transfer.cSshFCTransferTruncating.!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferClosing source file ``%s''...SshFCTransfersshfc_transfer.cSshFCTransferSource file '%s' removed successfully.rm_src: %sSshFCTransfersshfc_transfer.cSshFCTransferRemoving source file ``%s''...!(ssh_fsm_get_callback_flag(thread))sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferClosing dest file %s...SshFCTransfersshfc_transfer.cSshFCTransferFinished with file ``%s''.ctx != 0sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferAborting transfer...filesshfc_transfer.cSshFCTransferfilesshfc_transfer.cSshFCTransfersource != 0sshfc_transfer.cSshFCTransferfile_list != 0sshfc_transfer.cSshFCTransferdestination != 0sshfc_transfer.cSshFCTransferdest_path != 0sshfc_transfer.cSshFCTransferready_cb != 0sshfc_transfer.cSshFCTransfererror_cb != 0sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferFile list has %d files.No files to transfer.transfer_context->fsm != 0sshfc_transfer.cSshFCTransferattrs->ascii_extensions != 0sshfc_transfer.cSshFCTransferSshFCTransfersshfc_transfer.cSshFCTransferASCII mangling selected, source newline not set, determining at runtime.SshFCTransfersshfc_transfer.cSshFCTransferASCII mangling selected, dest newline not set, determining at runtime.attrs->newline_query_cb != 0sshfc_transfer.cSshFCTransfertransfer_context->main_thread != 0sshfc_transfer.cSshFCTransfermain_threadtdata != 0sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreDestroying request queues..tdata != 0sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreDestroying request.SshFCTransferCoresshfc_trcore.cSshFCTransferCoreDestroying request in progress.SshFCTransferCoresshfc_trcore.cSshFCTransferCoreFreeing buffer from queue...*.%sRegex library couldn't parse ASCII extension '%s'SshFCTransferCoresshfc_trcore.cSshFCTransferCore'%s' didn't match with '%s'.SshFCTransferCoresshfc_trcore.cSshFCTransferCoreFile ``%s'' will be mangled.source and destinationsourcedestination%s (src): Failed to get %s newline convention, consult software manual on how to set it manually. File will NOT be converted.nl_conv != 0sshfc_trcore.cSshFCTransferCoressh_fsm_get_callback_flag(thread)sshfc_trcore.cSshFCTransferCoregdata->attrs->transfer_mode & SSH_FC_TRANSFER_MODE_NL_CONV_ASKsshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreQuerying newline convention from user.gdata->attrs->newline_query_cb != 0sshfc_trcore.cSshFCTransferCore!(ssh_fsm_get_callback_flag(thread))sshfc_trcore.cSshFCTransferCoregdata->attrs->transfer_mode & SSH_FC_TRANSFER_MODE_NL_CONV_ASKsshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreQuerying newline convention from user.gdata->attrs->newline_query_cb != 0sshfc_trcore.cSshFCTransferCore!(ssh_fsm_get_callback_flag(thread))sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreStarting transfer for file %s, destination %sgdata->reader != 0sshfc_trcore.cSshFCTransferCorereadergdata->writer != 0sshfc_trcore.cSshFCTransferCorewriterSshFCTransferCoresshfc_trcore.cSshFCTransferCoreFile '%s' will be mangled.gdata->mangler != 0sshfc_trcore.cSshFCTransferCoremangler_tdata->req_queue != 0sshfc_trcore.cSshFCTransferCoresrc_attrs != 0sshfc_trcore.cSshFCTransferCoresrc_attrs->flags & 0x00000001sshfc_trcore.cSshFCTransferCoregdata->attrs->max_buf_sizesshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreoffset = %qd.ssh_adt_insert_to(tdata->req_queue, -1, new_req) != 0sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreFile was shredded to %ld buffers of size %ld (or less)SshFCTransferCoresshfc_trcore.cSshFCTransferCoreGot %ld bytes of data.ssh_adt_insert_to(tdata->req_queue, -1, new_req) != 0sshfc_trcore.cSshFCTransferCoreh != 0sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreAdding a write request to mangler's request queue.h != 0sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreAdding a write request to writer's request queue.h != 0sshfc_trcore.cSshFCTransferCoregot EOF reading fileunsupported operationno such filepermission deniedprotocol errorundefined error0sshfc_trcore.cSshFCTransferCoreconnection lostout of memoryssh_adt_insert_to(gdata->buf_queue, -1, req->buffer) != 0sshfc_trcore.cSshFCTransferCore%s (src): %s %s%s%sSshFCTransferCoresshfc_trcore.cSshFCTransferCoreNo more requests at this time.req != 0sshfc_trcore.cSshFCTransferCoregdata->attrs->max_bufferssshfc_trcore.cSshFCTransferCoreh != 0sshfc_trcore.cSshFCTransferCorebuf != 0sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreReading %ld bytes from offset %qd.ssh_adt_insert_to(tdata->in_progress_queue, -1, req) != 0sshfc_trcore.cSshFCTransferCoressh_adt_detach_object(tdata->in_progress_queue, req) != 0sshfc_trcore.cSshFCTransferCoressh_adt_insert_to(gdata->buf_queue, -1, req->buffer) != 0sshfc_trcore.cSshFCTransferCore0sshfc_trcore.cSshFCTransferCoressh_adt_insert_to(gdata->buf_queue, -1, req->buffer) != 0sshfc_trcore.cSshFCTransferCore%s (dst): %s %s%s%sSshFCTransferCoresshfc_trcore.cSshFCTransferCoreWriter finished.SshFCTransferCoresshfc_trcore.cSshFCTransferCoreNo more requests at this time.req != 0sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreWriting %ld bytes to offset %qd.ssh_adt_insert_to(tdata->in_progress_queue, -1, req) != 0sshfc_trcore.cSshFCTransferCoregdata->mangle_this_filesshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreNothing to mangle, finishing mangler.req != 0sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreAdding buffer contents to mangling window.ssh_adt_detach(l, h) == reqsshfc_trcore.cSshFCTransferCoressh_adt_insert_to(gdata->buf_queue, -1, req->buffer) != 0sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreWaiting for more requests.strcmp(gdata->src_newline, gdata->dest_newline) != 0sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCoreAdding rest of file to write buffer (no room for newline (%ld)).ssh_adt_insert_to(writer_tdata->req_queue, -2, new_req) != 0sshfc_trcore.cSshFCTransferCoreSshFCTransferCoresshfc_trcore.cSshFCTransferCorefile_len = %qd, write_offset = %qd, tdata->read_offset = %qd.thread_context != 0sshfc_recurse.cSshFCRecursethread != 0sshfc_recurse.cSshFCRecursegdata != 0sshfc_recurse.cSshFCRecursetdata != 0sshfc_recurse.cSshFCRecursefile != 0sshfc_recurse.cSshFCRecurseSshFCRecursesshfc_recurse.cSshFCRecurseReceived error %s%s%s%d%s.%s (%s): OK %s%s%s%s (%s): received EOF %s%s%s%s (%s): no such file %s%s%s%s (%s): permission denied %s%s%s%s (%s): unspecified failure %s%s%s%s (%s): operation unsupported %s%s%stdata->status_cb != 0sshfc_recurse.cSshFCRecursetdata->handle_cb != 0sshfc_recurse.cSshFCRecursetdata->data_cb != 0sshfc_recurse.cSshFCRecursetdata->name_cb != 0sshfc_recurse.cSshFCRecursetdata->attrs_cb != 0sshfc_recurse.cSshFCRecursefcr_transfer_callback: Got SSH_FX_NO_CONNECTION, even though we wait for the version. (this is a bug)%s (%s): connection lost%s (%s): bad message%s (%s): out of memoryssh_fsm_get_callback_flag(thread)sshfc_recurse.cSshFCRecurseConnecting to source failedssh_fsm_get_callback_flag(thread)sshfc_recurse.cSshFCRecurseSshFCRecursesshfc_recurse.cSshFCRecurseSource connection OK.SshFCRecursesshfc_recurse.cSshFCRecurseEstablishing source connection.!(ssh_fsm_get_callback_flag(thread))sshfc_recurse.cSshFCRecursect_ctx->cur_loc != 0sshfc_recurse.cSshFCRecursect != 0sshfc_recurse.cSshFCRecurseSshFCRecursesshfc_recurse.cSshFCRecurseNo more files in this list.tdata->list_to_addsshfc_recurse.cSshFCRecurseSshFCRecursesshfc_recurse.cSshFCRecurseProcessing file ``%s''...SshFCRecursesshfc_recurse.cSshFCRecurseFile ``%s'' is "raw", and it needs to be parsed.attrs != 0sshfc_recurse.cSshFCRecurseSshFCRecursesshfc_recurse.cSshFCRecurseFile %s needs to be statted.fcr_process: %s: Max symlink count for depth exceeded (we have very probably encountered a symlink loop. See man-page for scp2).SshFCRecursesshfc_recurse.cSshFCRecurseRecurseFileFunc returned 0 (zero), ignoring `%s'.ret_val & 0x1sshfc_recurse.cSshFCRecurseh != 0sshfc_recurse.cSshFCRecursenew_file != 0sshfc_recurse.cSshFCRecurseSshFCRecursesshfc_recurse.cSshFCRecurseFile ``%s'' is a directory, descending...SshFCRecursesshfc_recurse.cSshFCRecurseFile ``%s'' has directory entries, descending...tdata->cur_loc->dir_entries != 0sshfc_recurse.cSshFCRecursectsshfc_recurse.cSshFCRecursect_ctx->cur_loc != 0sshfc_recurse.cSshFCRecursect != 0sshfc_recurse.cSshFCRecurseSshFCRecursesshfc_recurse.cSshFCRecurseNo more files in this list.file != 0sshfc_recurse.cSshFCRecursefcr_parse_raw: %stdata->cur_loc != 0sshfc_recurse.cSshFCRecurse!(ssh_fsm_get_callback_flag(thread))sshfc_recurse.cSshFCRecursefcr_stat: %s!(ssh_fsm_get_callback_flag(thread))sshfc_recurse.cSshFCRecurse!(ssh_fsm_get_callback_flag(thread))sshfc_recurse.cSshFCRecursefcr_opendir: %stdata->cur_loc->dir_entries != 0sshfc_recurse.cSshFCRecurseSshFCRecursesshfc_recurse.cSshFCRecurseOpening directory ``%s''...!(ssh_fsm_get_callback_flag(thread))sshfc_recurse.cSshFCRecurse...fcr_readdir: %stdata->cur_loc != 0sshfc_recurse.cSshFCRecursetdata->cur_loc->handle != 0sshfc_recurse.cSshFCRecurse!(ssh_fsm_get_callback_flag(thread))sshfc_recurse.cSshFCRecurseRecursion complete.source != 0sshfc_recurse.cSshFCRecursefile_list != 0sshfc_recurse.cSshFCRecurseready_cb != 0sshfc_recurse.cSshFCRecurseerror_cb != 0sshfc_recurse.cSshFCRecurserecurse_context->fsm != 0sshfc_recurse.cSshFCRecurserecurse_context->main_thread != 0sshfc_recurse.cSshFCRecursemain_threadssh_debug_set_level_string: Invalid numeric argument for %sssh_debug_set_level_string: Ignored junk after command : %sglobal%08x: %02x %02x %c%s(((&fdset)->fds_bits[(filedes)/(sizeof (fds_mask) * 8)] & (1ul << ((filedes) % (sizeof (fds_mask) * 8)))) != 0l)sshdebug.cSshDebugerrno != 0sshdebug.cSshDebugresult == 1sshdebug.cSshDebugPrecondition failedPostcondition failedAssertion failedInvariant failedVerified expression failedUnreachable code failedInvalid code reached.unknown generic_assert(file unavailable)(module unavailable)(function name unavailable)%s:%d %s %s %s: %s%m/%s:%n: %MSSH_DEBUG_FMTOut of memory while parsing debug format stringOut of memory while parsing debug format stringHOST<%s unset>Don't know how to get function name for debugging output, %%f won't work.%Invalid or unsupported debug format control character '%c'.Invalid debug format string.Check the contents of your SSH_DEBUG_FMT environment variable.Could not allocate memory for fallback debug format itemsInternal bug in ssh_debug_eval_condition.Internal bug in ssh_debug_eval_condition.Internal error in ssh_debug_output (ssh_debug_format_items == NULL).Internal bug in if-clause handling in ssh_debug_output.%02d%02d%02d%04d%02d%02d%d%d%d%d%d%dInternal error in ssh_debug_output.total_len <= 4096 - 1sshdebug.cSshDebug%sDebug indentation level set below zero (check your code).(ssh_global_size_of_table & (ssh_global_size_of_table - 1)) == 0sshglobals.cSshGlobals(p->hash & (old_size - 1)) == isshglobals.cSshGlobalsUse of uninitialized global variable %sDuplicate initialization of the variable %s*Junk after port pattern: %.20sInvalid number in port pattern: %.20sSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDeccalendar_ret->month < 12sshtime.cSshTime%04d%02d%02d%02d%02d%02d +%02d%02d -%02d%02d%s %s %02d %04d %02d:%02d:%02d%sSshTimesshtime.cSshTimeOriginal time is %04d-%02d-%02d %02d:%02d:%02dSshTimesshtime.cSshTimeSeconds too large, adjusting %dSshTimesshtime.cSshTimeMinutes too large, adjusting %dSshTimesshtime.cSshTimeHours too large, adjusting %dSshTimesshtime.cSshTimeMonth too large, adjusting %dSshTimesshtime.cSshTimeMonth day too large, adjusting %dSshTimesshtime.cSshTimeMonth day zero, adjusting %dSshTimesshtime.cSshTimeAdjusted time is %04d-%02d-%02d %02d:%02d:%02dSshTimesshtime.cSshTimeEstimate is %ldSshTimesshtime.cSshTimeCompare time is %04d-%02d-%02d %02d:%02d:%02dInternal error in ssh_make_timeSshTimesshtime.cSshTimeUtc offset in input does not match current system timezone. Dst rules might be incorrectSshTimesshtime.cSshTimeAdding timezone informartion %d secondsSshTimesshtime.cSshTimeResult is %ldTrying to print number with width more than %d%d.%dshift_ofs >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft > 0sshsnprintf.cSshSPrintf0123456789left >= 0sshsnprintf.cSshSPrintfshift_ofs >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintf0123456789abcdefleft >= 0sshsnprintf.cSshSPrintfshift_ofs >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfshift_ofs >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintf01234567left >= 0sshsnprintf.cSshSPrintfshift_ofs >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintf0123456789left >= 0sshsnprintf.cSshSPrintfshift_ofs >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfreturn_value <= left + 1sshsnprintf.cSshSPrintfshift_ofs >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfreturn_value >= 0sshsnprintf.cSshSPrintfreturn_value <= leftsshsnprintf.cSshSPrintfshift_ofs >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintf(null)left >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfshift_ofs >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfshift_ofs >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfleft >= 0sshsnprintf.cSshSPrintfstr != 0sshsnprintf.cSshSPrintfformat != 0sshsnprintf.cSshSPrintfstr != 0sshsnprintf.cSshSPrintfformat != 0sshsnprintf.cSshSPrintfssh_xdvsprintf(): memory allocation failed.buffer != 0sshbuffer.cSshBufferbuffer->dynamicsshbuffer.cSshBufferbuffer != 0sshbuffer.cSshBufferbuffer != 0sshbuffer.cSshBufferbuffer != 0sshbuffer.cSshBufferbuffer != 0sshbuffer.cSshBufferbuffer != 0sshbuffer.cSshBuffer!buffer->borrowedsshbuffer.cSshBuffer0sshbuffer.cSshBufferbuffer != 0sshbuffer.cSshBufferbuffer->offset <= buffer->endsshbuffer.cSshBufferbuffer != 0sshbuffer.cSshBufferbuffer->offset <= buffer->endsshbuffer.cSshBufferbuffer->end <= buffer->allocsshbuffer.cSshBufferbuffer_consume trying to get more bytes than in bufferbuffer_consume_end trying to get more bytes than in bufferbuffer != 0sshbuffer.cSshBufferbuffer->offset <= buffer->endsshbuffer.cSshBufferCan not allocate a buffer. Not enough memory.Can not append %d bytes to buffer. Not enough memory.Can not append %d bytes empty space to buffer. Not enough memory.Can not append strings to buffer. Not enough memory.illegal option -- %c option requires an argument -- %c argvsshgetopt.cSshGetOptshortoptssshgetopt.cSshGetOptlongoptssshgetopt.cSshGetOptinvalid argument %stoken != 0sshgetopt.cSshGetOpt%s option '%s'token != 0sshgetopt.cSshGetOpt*c == '\0' || *c == '='sshgetopt.cSshGetOptlind >= 0sshgetopt.cSshGetOptoption '--%s' does not take argumentsoption '--%s' requires an argumentinvalid values in the long options vectorILLEGAL INPUT (0x%02x) - FATAL PARSING ERROR%s: %s UNKNOWN STATE - FATAL PROGRAM ERRORtimer != 0sshtimemeasure.cSshTimeMeasuretimer != 0sshtimemeasure.cSshTimeMeasuretimer != 0sshtimemeasure.cSshTimeMeasuretimer != 0sshtimemeasure.cSshTimeMeasuressh_time_measure_stamp: Bad granularity.ssh_time_measure_stamp: Bad granularity.beg != 0sshtimemeasure.cSshTimeMeasureend != 0sshtimemeasure.cSshTimeMeasureSshTimeMeasuresshtimemeasure.cSshTimeMeasureNegative time difference: beg(%lu %lu) > end(%lu %lu).ssh_time_measure_difference: Negative difference.tv1 != 0sshtimemeasure.cSshTimeMeasuretv2 != 0sshtimemeasure.cSshTimeMeasuressh_time_measure_system_time: gettimeofday failed.Reallocating block that is already freedReallocating block that is either not mallocated, or whose magic number before the object was overwrittenApplication concept of old size does not match the block being reallocated: %ld vs %ldReallocating block whose magic number after the object was overwrittenFreeing block that is already freedFreeing block that is either not mallocated, or whose magic number before the object was overwrittenFreeing block whose magic number after the object was overwrittenssh_xmalloc: Can not allocate %ld bytes of memory.ssh_xcalloc: Can not allocate %ld bytes of memory.ssh_xrealloc: Can not allocate %ld bytes of memory.ssh_xstrdup: Can not duplicate a NULL string.ssh_xstrdup: Can not duplicate string.ssh_xmemdup: Can not duplicate %d bytes of memory.SshADTsshadt.cSshADTCopying %d bytes from %p to %p.type != 0sshadt.cSshADTSshADTsshadt.cSshADTRegistered callback context @%p.SshADTsshadt.cSshADTRegistered compare callback @%p.SshADTsshadt.cSshADTRegistered copy callback @%p.SshADTsshadt.cSshADTRegistered duplicate callback @%p.SshADTsshadt.cSshADTRegistered destroy callback @%p.SshADTsshadt.cSshADTRegistered hash callback @%p.SshADTsshadt.cSshADTRegistered init callback @%p.SshADTsshadt.cSshADTRegistered map_attach callback @%p.SshADTsshadt.cSshADTRegistered map_detach callback @%p.SshADTsshadt.cSshADTRegistered cleanup callback @%p.0sshadt.cSshADTcontainer->f.app_methods.duplicate != 0sshadt.cSshADTSshADTsshadt.cSshADTInvoking callback @%p.SshADTsshadt.cSshADTCallback @%p returned.container != 0sshadt.cSshADT((container)->f.default_object_size) == 0sshadt.cSshADTcontainer != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) == 0sshadt.cSshADThandle != 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.insert_at != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) == 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.insert_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) == 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.insert_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) == 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.insert_at != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) == 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.insert_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) == 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.insert_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer->static_data->methods.alloc_n_at != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADTcontainer->static_data->methods.alloc_n_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer->static_data->methods.alloc_n_at != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADTcontainer->static_data->methods.alloc_n_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADTcontainer->static_data->methods.alloc_n_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADTcontainer->static_data->methods.alloc_n_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADThandle != 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.put_n_at != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.put_n_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADThandle != 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.put_n_at != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.put_n_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.put_n_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) != 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.put_n_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer->static_data->methods.get != 0sshadt.cSshADTcontainer != 0sshadt.cSshADTcontainer->static_data->methods.num_objects != 0sshadt.cSshADTcontainer != 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.get_handle_to != 0sshadt.cSshADTcontainer != 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.get_handle_to_equal != 0sshadt.cSshADTcontainer != 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.get_handle_to_equal != 0sshadt.cSshADTcontainer != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer->static_data->methods.next != 0sshadt.cSshADTcontainer != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer->static_data->methods.previous != 0sshadt.cSshADTcontainer != 0sshadt.cSshADTcontainer->static_data->methods.get_handle_to_location != 0sshadt.cSshADTcontainer != 0sshadt.cSshADTcontainer->static_data->methods.get_handle_to_location != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) == 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer->static_data->methods.detach != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) == 0sshadt.cSshADTcontainer->static_data->methods.detach != 0sshadt.cSshADTcontainer->static_data->methods.get_handle_to_location != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer != 0sshadt.cSshADT((container)->f.default_object_size) == 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.detach != 0sshadt.cSshADTcontainer->static_data->methods.get_handle_to != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer->static_data->methods.delet != 0sshadt.cSshADTcontainer != 0sshadt.cSshADTcontainer->static_data->methods.delet != 0sshadt.cSshADTcontainer->static_data->methods.get_handle_to_location != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer != 0sshadt.cSshADTobject != 0sshadt.cSshADTcontainer->static_data->methods.delet != 0sshadt.cSshADTcontainer->static_data->methods.get_handle_to != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer != 0sshadt.cSshADTcontainer->static_data->methods.enumerate_start != 0sshadt.cSshADTcontainer != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer->static_data->methods.enumerate_next != 0sshadt.cSshADTcontainer != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer->static_data->methods.map_lookup != 0sshadt.cSshADTcontainer != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer->static_data->methods.map_attach != 0sshadt.cSshADTcontainer != 0sshadt.cSshADThandle != 0sshadt.cSshADTcontainer->static_data->methods.detach != 0sshadt.cSshADTSshADTListsshadt_list.cSshADTList*** You have provided a hash callback for a list.SshADTListsshadt_list.cSshADTList*** Please report to maintainer.SshADTListsshadt_list.cSshADTListInvoking callback @%p.SshADTListsshadt_list.cSshADTListCallback @%p returned.SshADTListsshadt_list.cSshADTListReference to non-existent callback (doing nothing).0sshadt_list.cSshADTListSshADTListsshadt_list.cSshADTListinserting %p failed.SshADTListsshadt_list.cSshADTListinserting %p failed.SshADTListsshadt_list.cSshADTListWARNING: list does not contain element %i.n != 0sshadt_list.cSshADTListn != 0sshadt_list.cSshADTListn != 0sshadt_list.cSshADTListn != 0sshadt_list.cSshADTListSshADTListsshadt_list.cSshADTListinsert: bad position '%i'.SshADTListsshadt_list.cSshADTListinserting %p failed (alloc).SshADTListsshadt_list.cSshADTListinserting %p failed (init).SshADTListsshadt_list.cSshADTListInvoking callback @%p.SshADTListsshadt_list.cSshADTListCallback @%p returned.SshADTListsshadt_list.cSshADTListReference to non-existent callback (doing nothing).SshADTListsshadt_list.cSshADTListInvoking callback @%p.SshADTListsshadt_list.cSshADTListCallback @%p returned.SshADTListsshadt_list.cSshADTListReference to non-existent callback (doing nothing).SshADTListsshadt_list.cSshADTListInvoking callback @%p.SshADTListsshadt_list.cSshADTListCallback @%p returned.SshADTListsshadt_list.cSshADTListReference to non-existent callback (doing nothing).SshADTListsshadt_list.cSshADTListInvoking callback @%p.SshADTListsshadt_list.cSshADTListCallback @%p returned.SshADTListsshadt_list.cSshADTListReference to non-existent callback (doing nothing).h != 0sshadt_list.cSshADTListh != 0sshadt_list.cSshADTListn->next == 0sshadt_list.cSshADTListn->next != 0sshadt_list.cSshADTListn->prev == 0sshadt_list.cSshADTListn->prev != 0sshadt_list.cSshADTListr != 0sshadt_list.cSshADTListn != 0sshadt_list.cSshADTListn->next != 0sshadt_list.cSshADTListn->prev != 0sshadt_list.cSshADTListn->next->prev == nsshadt_list.cSshADTListn->prev->next == nsshadt_list.cSshADTListSshADTListsshadt_list.cSshADTListDetach: handle=%pc->f.app_methods.compare != 0sshadt_list.cSshADTListSshADTListsshadt_list.cSshADTListInvoking callback @%p.SshADTListsshadt_list.cSshADTListCallback @%p returned.SshADTListsshadt_list.cSshADTListInvoking callback @%p.SshADTListsshadt_list.cSshADTListCallback @%p returned.SshADTListsshadt_list.cSshADTListReference to non-existent callback (doing nothing).c->static_data == ssh_adt_list_typesshadt_list.cSshADTListc->f.app_methods.compare != 0sshadt_list.cSshADTListSshADTListsshadt_list.cSshADTListInvoking callback @%p.SshADTListsshadt_list.cSshADTListCallback @%p returned.c->f.app_methods.compare != 0sshadt_list.cSshADTListSshADTListsshadt_list.cSshADTListInvoking callback @%p.SshADTListsshadt_list.cSshADTListCallback @%p returned.i < 64sshadt_list.cSshADTListc->f.app_methods.compare != 0sshadt_list.cSshADTListSshADTListsshadt_list.cSshADTListInvoking callback @%p.SshADTListsshadt_list.cSshADTListCallback @%p returned.c->static_data->methods.map_attach != 0sshadt_conv.cSshADTConvc->static_data->methods.map_lookup != 0sshadt_conv.cSshADTConv!(ssh_adt_xmap_exists(c, key))sshadt_conv.cSshADTConvssh_adt_xmap_exists(c, key)sshadt_conv.cSshADTConvc->static_data->methods.map_attach != 0sshadt_conv.cSshADTConvc->static_data->methods.map_lookup != 0sshadt_conv.cSshADTConvc->static_data->methods.map_attach != 0sshadt_conv.cSshADTConvc->static_data->methods.map_lookup != 0sshadt_conv.cSshADTConvc->static_data->methods.map_attach != 0sshadt_conv.cSshADTConvc->static_data->methods.map_lookup != 0sshadt_conv.cSshADTConvc->static_data->methods.map_attach != 0sshadt_conv.cSshADTConvc->static_data->methods.map_lookup != 0sshadt_conv.cSshADTConvSshEventLoopsshunixeloop.cSshEventLoopTime moved backwards, adjusting timeouts backwards by %d secondsSshEventLoopsshunixeloop.cSshEventLoopTimeout was registered at %d.SshEventLoopsshunixeloop.cSshEventLoopNew timeout is registered at %d.SshEventLoopsshunixeloop.cSshEventLoopInitialized the event loop.ssh_eloop_initializedsshunixeloop.cssh_eloop_initializedsshunixeloop.cSshEventLoopsshunixeloop.cSshEventLoopUninitialized the event loop.SshEventLoopsshunixeloop.cSshEventLoopGot signal number: %dsig > 0 && sig <= NSIGsshunixeloop.cmicroseconds >= 0 && microseconds < 1000000Lsshunixeloop.cseconds >= 0sshunixeloop.cmicroseconds >= 0sshunixeloop.cssh_eloop_initializedsshunixeloop.cSshEventLoopsshunixeloop.cSshEventLoopWarning: truncating timeout to 1000000000 seconds: was %ldSshEventLoopsshunixeloop.cSshEventLoopTimeout registered at %d.SshEventLoopsshunixeloop.cSshEventLoopIdle timeouts not yet implemented.ssh_eloop_initializedsshunixeloop.cSshEventLoopsshunixeloop.cSshEventLoopRemoved timeout at %d.ssh_eloop_initializedsshunixeloop.cSshEventLoopsshunixeloop.cSshEventLoopRegistering bad signal %d ignored.SshEventLoopsshunixeloop.cSshEventLoopRegistered signal %d.ssh_eloop_initializedsshunixeloop.cSshEventLoopsshunixeloop.cSshEventLoopUnregistering bad signal %d ignored.SshEventLoopsshunixeloop.cSshEventLoopReissuing signal for which callback was not yet delivered.SshEventLoopsshunixeloop.cSshEventLoopUnregistered signal %d.ssh_eloop_initializedsshunixeloop.cfd < 10000sshunixeloop.cssh_io_register_fd: fd %d already registered!SshEventLoopsshunixeloop.cSshEventLoopRegistered file descriptor %d.ssh_eloop_initializedsshunixeloop.cSshEventLoopsshunixeloop.cSshEventLoopKilled the file descriptor %d, waiting for removalssh_io_unregister_fd: file descriptor %d was not found.File descriptor %d exceeded the array size in ssh_io_set_fd_request.SshEventLoopsshunixeloop.cSshEventLoopStarting the event loop.ssh_eloop_initializedsshunixeloop.cSshEventLoopsshunixeloop.cSshEventLoopCalling a signal handler.SshEventLoopsshunixeloop.cSshEventLoopCalling a timeout callback.SshEventLoopsshunixeloop.cSshEventLoopSelect timeout: %ld seconds, %ld usec.SshEventLoopsshunixeloop.cSshEventLoopselect timeout: %ld %ldSshEventLoopsshunixeloop.cSshEventLoopSelect.Bad file descriptor in the event loop.SshEventLoopsshunixeloop.cSshEventLoopSelect exited because of a caught signal.Bad time limit in the event loop.SshEventLoopsshunixeloop.cSshEventLoopRemoved a killed IO callback.Tried to destroy a FSM that has %d thread(s) leftSshFSMsshfsm.cSshFSMFSM context destroyedTried to destroy a FSM that has %d thread(s) leftSshFSMsshfsm.cSshFSMFSM context uninitializedthread->waiting->status == SSH_FSM_T_WAITING_THREADsshfsm.cSshFSM%p%pSshFSMsshfsm.cSshFSMEntering the schedulerSshFSMsshfsm.cSshFSMNo active threads so return from schedulerthread->status == SSH_FSM_T_ACTIVEsshfsm.cSshFSM!(thread->flags & 1)sshfsm.cSshFSMSshFSMsshfsm.cSshFSMThread continuing from state `%s' (%s)msg_thr->message_handler != 0sshfsm.cSshFSMmsg_thr->flags & 2sshfsm.cSshFSMSshFSMsshfsm.cSshFSMDelivering the message %u to thread `%s'msg_thr->waited.condition != 0sshfsm.cSshFSMmsg_thr->waited.thread != 0sshfsm.cSshFSMSshFSMsshfsm.cSshFSMThread finished in state `%s'SshFSMsshfsm.cSshFSMThread suspended in state `%p'SshFSMsshfsm.cSshFSMThread waiting for a condition variable in state `%p'SshFSMsshfsm.cSshFSMThread waiting for a thread to terminate in state `%p'SshFSMsshfsm.cSshFSMStarting a new thread starting from `%s'SshFSMsshfsm.cSshFSMContinue called from a message handlerSshFSMsshfsm.cSshFSMReactivating a suspended threadSshFSMsshfsm.cSshFSMReactivating a thread waiting for a condition variable (detaching from the condition)SshFSMsshfsm.cSshFSMReactivating a thread waiting for a thread to terminate (detaching from the thread)SshFSMsshfsm.cSshFSMReactivating an already active thread (do nothing)0sshfsm.cSshFSM!(thread->flags & 1)sshfsm.cSshFSMthread->flags & 1sshfsm.cSshFSMthread->status == SSH_FSM_T_ACTIVEsshfsm.cSshFSMcondition->waiting == 0sshfsm.cSshFSMcondition->waiting == 0sshfsm.cSshFSMSshFSMsshfsm.cSshFSMSignalling a condition variableSshFSMsshfsm.cSshFSMWaiting list emptycondition->waiting->status == SSH_FSM_T_WAITING_CONDITIONsshfsm.cSshFSMSshFSMsshfsm.cSshFSMOk, activating one of the waiting threadsthread->flags & 1sshfsm.cSshFSMthread->status == SSH_FSM_T_ACTIVEsshfsm.cSshFSMthread->fsm->flags & 1sshfsm.cSshFSMthread != recipientsshfsm.cSshFSMssh_stream_internal_callback: stream implementation generated a callback after close.ssh_stream_internal_callback: stream implementation generated a callback after disconnected notification!stream->closedsshstream.cSshStream!stream->disconnected || len == 0sshstream.cSshStream!stream->closedsshstream.cSshStream!stream->disconnected || len == 0sshstream.cSshStream!stream->closedsshstream.cSshStream!stream->closedsshstream.cSshStream!stream->closedsshstream.cSshStream!stream->closedsshstream.cSshStream!stream->closedsshstream.cSshStream!stream->closedsshstream.cSshStreamme->offset <= sizeof(me->buf)sshstreampair.cSshStreamPairoffset < sizeof(me->other->buf)sshstreampair.cSshStreamPairme->other->inbuf <= sizeof(me->other->buf)sshstreampair.cSshStreamPairbytes != 0sshstreampair.cSshStreamPairpair->references >= 0sshstreampair.cSshStreamPair((m->g)->subexpr_tree_allocator)->allocated > 0sshregex.cSshRegexsubexpr < m->num_matchessshregex.cSshRegexn->refcount > 0sshregex.cSshRegex(m->submatch_bitmask_allocator)->allocated > 0sshregex.cSshRegex((m->g)->subexpr_tree_allocator)->allocated > 0sshregex.cSshRegexSshRegexsshregex.cSshRegexOut of memory, cannot create thread.SshRegexsshregex.cSshRegexKilling thread %p.((m->g)->thread_allocator)->allocated > 0sshregex.cSshRegexSshRegexsshregex.cSshRegexStepping pos=%d data starts `%.5s'.SshRegexsshregex.cSshRegexThread=%p delay=%dSshRegexsshregex.cSshRegexState=%d (%p).SshRegexsshregex.cSshRegexSame tag found.SshRegexsshregex.cSshRegexCannot allocate new match tree item.SshRegexsshregex.cSshRegexCannot allocate new match tree item.SshRegexsshregex.cSshRegexOut of memory when forking new thread.Invalid type %dSshRegexsshregex.cSshRegexRunning the NB match.SshRegexsshregex.cSshRegexCould not start the initial thread.((c)->nfa_node_allocator)->allocated > 0sshregex.cSshRegexSshRegexsshregex.cSshRegexOut of memory when allocation an NFA node.SshRegexsshregex.cSshRegexOut of memory when reallocating NFA nodes array.((c)->nfa_node_allocator)->allocated > 0sshregex.cSshRegex(*ptr) != 0sshregex.cSshRegexSshRegexsshregex.cSshRegexSeeing forwarding node %d.f->incoming_edges > 0sshregex.cSshRegexSshRegexsshregex.cSshRegexStreamlining node %d.SshRegexsshregex.cSshRegexCould not allocate new array in `shrink_nodes_array' but can continue.SshRegexsshregex.cSshRegexOut of memory when copying NFA nodes array.SshRegexsshregex.cSshRegexOut of memory when copying NFA nodes.SshRegexsshregex.cSshRegexOut of memory when copying NFA nodes' literal data.SshRegexsshregex.cSshRegexOut of memory when allocating literal data.SshRegexsshregex.cSshRegexCopying NFA failed.tree->u.range.range_max > 1sshregex.cSshRegex0sshregex.cSshRegex0sshregex.cSshRegex%d 0sshregex.cSshRegexc->pc.in_stack >= (offset + 1)sshregex.cSshRegexSshRegexsshregex.cSshRegexOut of memory when growing the parse stack.c->pc.in_stack > 0sshregex.cSshRegexc->pc.in_stack > 0sshregex.cSshRegexSshRegexsshregex.cSshRegexOut of memory when allocating a new tree node.SshRegexsshregex.cSshRegexReleasing a binary tree node.((c)->tree_allocator)->allocated > 0sshregex.cSshRegexSshRegexsshregex.cSshRegexCollapsing...stack_ref(c, 1)->right == 0sshregex.cSshRegex0sshregex.cSshRegexalnumalphacntrldigitgraphlowerprintpunctspaceupperxdigitSshRegexsshregex.cSshRegexReading next token, mode=%d str=`%.5s'.mode == SSH_REX_PARSE_ALL_LITERALsshregex.cSshRegexSshRegexsshregex.cSshRegexSyntax class=%d.SshRegexsshregex.cSshRegexNot a charset after lookahead/back. SshRegexsshregex.cSshRegexStarting to preparse the regex `%s'.SshRegexsshregex.cSshRegex: %s((c)->tree_allocator)->allocated > 0sshregex.cSshRegex((c)->tree_allocator)->allocated > 0sshregex.cSshRegex((c)->tree_allocator)->allocated > 0sshregex.cSshRegex((c)->tree_allocator)->allocated > 0sshregex.cSshRegex((c)->tree_allocator)->allocated > 0sshregex.cSshRegex((c)->tree_allocator)->allocated > 0sshregex.cSshRegexSshRegexsshregex.cSshRegexRanges %d %d.c->e != SSH_REGEX_OKsshregex.cSshRegexc->e != SSH_REGEX_OKsshregex.cSshRegexc->e != SSH_REGEX_OKsshregex.cSshRegexc->e != SSH_REGEX_OKsshregex.cSshRegexc->e != SSH_REGEX_OKsshregex.cSshRegexc->e != SSH_REGEX_OKsshregex.cSshRegexc->e != SSH_REGEX_OKsshregex.cSshRegexSshRegexsshregex.cSshRegexSemantically invalid regular expression.c->e != SSH_REGEX_OKsshregex.cSshRegexSshRegexsshregex.cSshRegexFailed to compile.Unknown regular expression syntax %d.SshRegexsshregex.cSshRegexCompiling regex `%s' failed.c->e != SSH_REGEX_OKsshregex.cSshRegexabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789_0123456789 {^>~w}|{<~w$}|{<~W>~w}|{<~w>~W}{<~w>~w}|{<~W>~W}|{^>~W}|{<~W$}{^|<~W}>~w<~w{$|>~W}{^|<[~f~n~r]}{$|>[~f~n~r]}{{{{^|<[/]}[-./]}|{<[-/][-/]}}[-/]*}?{{{{^|<[/]}[-.]}|{<[-/].}}*~/}?{{{^|<[/]}[-/.]}|{<[-/][-/]}}matcher != 0sshregex.cSshRegexitems != 0sshregex.cSshRegexnum_items >= 0sshregex.cSshRegexlength_return != 0sshregex.cSshRegexptr == dst + total_lensshregex.cSshRegexn_regexs > 0sshregex.cSshRegexflags & 0x0001sshregex.cSshRegexinternal error in ssh_dlex_createresultsshregex.cSshRegexidx == 0sshregex.cSshRegex0sshregex.cSshRegexSshEncodesshencode.cSshEncodeFormat = 0x%X0sshencode.cSshEncodeSshEncodesshencode.cSshEncodeBefore renderer: b->end = %d, space = %dSshEncodesshencode.cSshEncodeAfter renderer: b->end = %d, i = %dSshEncodesshencode.cSshEncodeInsufficient buffer space0sshencode.cSshEncodeSshEncodesshencode.cSshEncodeFormat = 0x%XSshEncodesshencode.cSshEncodeoffset = %dSshEncodesshencode.cSshEncodeinvalid format code %d kMGTPEInvalid scale in the ssh_format_number, must be 1024 or 1000%d%d.%d%c%d%c%02d:%02d:%02d%d+%02d:%02d%d+%02d%d-rbUnknown file format given to ssh_read_gen_file-wb-w%s %s -w%08lx: %02x %c. Unknown file format given to ssh_read_gen_file!sdata->destroyedsshunixfdstream.c!sdata->destroyedsshunixfdstream.c!sdata->destroyedsshunixfdstream.c!sdata->destroyedsshunixfdstream.c!sdata->destroyedsshunixfdstream.c!sdata->destroyedsshunixfdstream.cSshReadLinesshreadline.cSshReadLineFailed to set modes for read fd.SshReadLinesshreadline.cSshReadLineFailed to set modes for write fd.tcgetattr failed in ssh_rl_set_tty_modes_for_fd: fd %d: %.200stcsetattr failed in ssh_rl_set_tty_modes_for_fd: fd %d: %.200stcsetattr failed in ssh_rl_restore_tty_modes_for_fd: fd %d: %.200sSshReadLinesshreadline.cSshReadLineIgnored empty terminal string.Write failed in ssh_rl_send_string: EOF receivedWrite failed in ssh_rl_send_string: %.200sSshReadLinesshreadline.cSshReadLinecode before tparm():SshReadLinesshreadline.cSshReadLinecode after tparm(): SshReadLinesshreadline.cSshReadLinecommand history:SshReadLinesshreadline.cSshReadLine%d: `%s'SshReadLinesshreadline.cSshReadLineAdding line `%s' to end.h != 0sshreadline.cSshReadLineSshReadLineSshReadLinesshreadline.cSshReadLineItem different in command history, replacing.ssh_adt_insert_at(rl->cmd_hist, SSH_ADT_AFTER, rl->ch, ssh_xstrdup(rl->line)) != 0sshreadline.cSshReadLineSshReadLineSshReadLinesshreadline.cSshReadLineItem different in command history, replacing.ssh_adt_insert_at(rl->cmd_hist, SSH_ADT_AFTER, rl->ch, ssh_xstrdup(rl->line)) != 0sshreadline.cSshReadLineSshReadLineSshReadLinesshreadline.cSshReadLineret: %ld, read_len: %d, buf_len: %ldSshReadLinesshreadline.cSshReadLinegot %d bytes:SshReadLinesshreadline.cSshReadLinepartial match on cursor key.SshReadLinesshreadline.cSshReadLinepartial match on cursor key.SshReadLinesshreadline.cSshReadLinepartial match on cursor key.SshReadLinesshreadline.cSshReadLinepartial match on cursor key.SshReadLinesshreadline.cSshReadLineentering timeoutSshReadLinesshreadline.cSshReadLinerestarting read()rl->ch != 0sshreadline.cSshReadLineTERMSetting up terminal for term `%s' failed.SshReadLinesshreadline.cSshReadLinereason: Terminal is a hardcopy, cannot be used for curses.SshReadLinesshreadline.cSshReadLinereason: Terminal entry could not be found, or it is a generic type which has too little information for curses applications to run.SshReadLinesshreadline.cSshReadLinereason: Terminfo database could not be found.SshReadLinesshreadline.cSshReadLinereason: Unknown error with setupterm().SshReadLinesshreadline.cSshReadLinesmkx:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinermkx:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLineel:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinehpa:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinedch:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinedch1:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLineich:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLineich1:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinecud:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinecud1:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinecub:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinecub1:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinecuf:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinecuf1:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinecuu:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinecuu1:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLineflash:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinekcud1:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinekcub1:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinekcuf1:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".SshReadLinesshreadline.cSshReadLinekcuu1:SshReadLinesshreadline.cSshReadLineterm does not have cap "%s".Need basic cursor movement capability, using vt100Write failed in ssh_rl_send_string: EOF received.rl != 0sshreadline.cSshReadLineSshReadLinesshreadline.cSshReadLineSetting tty modes failed. SshReadLinesshreadline.cSshReadLineInitializing ReadLine...rl->cmd_hist != 0sshreadline.cSshReadLineSshReadLinesshreadline.cSshReadLineUninitializing ReadLine...Fatal: ssh_readline LINE is NULL ssh_pipe_sigchld_do_callbackssh_pipe_sigchld_handler: pid %d status %dssh_pipe_sigchld_handler: status already returnedFork failed: %sdup2 stdindup2 stdoutdup2 stderrssh_pipe_get_exit_status called before the child has exited.ssh_pipe_stream_read: faking eof after sigchldssh_pipe_stream_destroySshSigChldsigchld.cSshSigChldcalling handler pid %d code %dSshSigChldsigchld.cSshSigChldno handler for pid %d code %d, adding orphan recordSshSigChldsigchld.cSshSigChldCleaning up old orphan (age: %ld, pid: %d).ssh_sigchld_process_pid: couldn't allocate memory for orphan record (pid: %d)SshSigChldsigchld.cSshSigChldSIGCHLD received.ssh_sigchld_initialize: couldn't allocate orphan listSshSigChldsigchld.cSshSigChldRegistering handler for pid %d.orphan != 0sigchld.cSshSigChldSshSigChldsigchld.cSshSigChldCalling SIGCHLD handler callback for orphan %d.tcsetattrtcgetattrtcsetattrssh_file_client_open: internal error converting flagsConnection lostenConnection lostenConnection lostenConnection lostenNo connection yetenConnection lostenNo connection yetenConnection lostenConnection lostenConnection lostenConnection lostenConnection lostenConnection lostenConnection lostenConnection lostenConnection lostenclient != 0sshfilexferc.cSshFileXferClientConnection lostenConnection lostenRENAME is not supported by serverenConnection lostenREADLINK is not supported by serverenConnection lostenSYMLINK is not supported by serverenConnection lostenEXTENDED_REQUEST is not supported by serverenfile-content-hash-1@ssh.comfile-content-hash-1@ssh.comclient->server_extensions != 0sshfilexferc.cSshFileXferClientSshFileXferClientsshfilexferc.cSshFileXferClientssh_file_client_return_status: id %d not found, error %dfile-content-hash-1@ssh.comUnknown extended type "%s"in ssh_file_client_return_status()ssh_file_client_eof_proc: bad expect %d!client->eof_receivedsshfilexferc.cSshFileXferClientrequest != 0sshfilexferc.cSshFileXferClientrequest->expected_reply == SSH_FILEXFER_EXTENDED_REPLYsshfilexferc.cSshFileXferClientfile-content-hash-1@ssh.comBad message from server with EXTENDED_REPLY (type file-content-hash-1@ssh.com)enSshFileXferClientsshfilexferc.cSshFileXferClientServer used hash %s.ssh_file_client_process_extended_reply: Unknown extended type ``%s''.filexfer_client: Received malformed VERSION packetfilexfer_client: Received malformed extension data in VERSION packet.SshFileXferClientsshfilexferc.cSshFileXferClientext_name `%s', data:filexfer_client: Received extra data at end of VERSION packetfilexfer_client: bad STATUS (ver 3)filexfer_client: bad STATUS (ver <= 2)filexfer_client: bad HANDLESshFileXferClientsshfilexferc.cSshFileXferClientfilexfer_client: unknown HANDLESshFileXferClientsshfilexferc.cSshFileXferClientfilexfer_client: unexpected HANDLEfilexfer_client: bad DATAfilexfer_client: unknown DATASshFileXferClientsshfilexferc.cSshFileXferClientfilexfer_client: unexpected DATAfilexfer_client: bad NAMEfilexfer_client: unknown NAMEfilexfer_client: unexpected NAMESshFileXferClientsshfilexferc.cSshFileXferClientfilexfer_client: null handle and %lu names.filexfer_client: bad NAMEfilexfer_client: bad attrs in NAMESshFileXferClientsshfilexferc.cSshFileXferClientfilexfer_client: names still leftfilexfer_client: bad NAME %dfilexfer_client: bad NAME %dEOFenfilexfer_client: bad ATTRSfilexfer_client: unknown ATTRSfilexfer_client: unexpected ATTRSfilexfer_client: bad EXTENDED_REPLYfilexfer_client: unknown EXTENDED_REPLYSshFileXferClientsshfilexferc.cSshFileXferClientfilexfer_client: unexpected EXTENDED_REPLYSshFileXferClientsshfilexferc.cSshFileXferClientfilexfer_client: unexpected packet %dConnection lostenConnection lostenext_rec != 0sshfilexferc.cSshFileXferClienthandle->len > 0sshfilexfers.cSsh2SftpServerssh_file_server_find_handle: handle not foundssh_file_server_free_handle: handle not foundserver != 0sshfilexfers.cSsh2SftpServergot EXTENDED request %sfile-content-hash-1@ssh.comSsh2SftpServersshfilexfers.cSsh2SftpServerProcessing extended request (len: %ld):Ssh2SftpServersshfilexfers.cSsh2SftpServerInvalid extended request %senInvalid data in extended request ``%s''Ssh2SftpServersshfilexfers.cSsh2SftpServerInvalid handle.enHandle not found.Ssh2SftpServersshfilexfers.cSsh2SftpServerStat failed.enstat failed. syserr: %s, file: %sSsh2SftpServersshfilexfers.cSsh2SftpServerTrying to hash beyond EOF (size: %ld, start_offset: %ld, len: %ld.enTrying to hash beyond EOF.Ssh2SftpServersshfilexfers.cSsh2SftpServerSupported hashes by client: %sSsh2SftpServersshfilexfers.cSsh2SftpServerHash not supported (or memory allocation failed.enNo supported hashes in list "%s".Ssh2SftpServersshfilexfers.cSsh2SftpServerIntersection with our hashes: %sSsh2SftpServersshfilexfers.cSsh2SftpServerUsed hash: %sSsh2SftpServersshfilexfers.cSsh2SftpServerFailed to allocate hash %s.enFailed to allocate hash %s.Ssh2SftpServersshfilexfers.cSsh2SftpServerReading %ld bytesSsh2SftpServersshfilexfers.cSsh2SftpServerRead returned %denGot EOF (file truncated?).ensyserr: %s, file: %sSsh2SftpServersshfilexfers.cSsh2SftpServerdigest (len: %ld):Ssh2SftpServersshfilexfers.cSsh2SftpServerReceived unknown extended request type ``%s''enextended request type ``%s'' not supported.JanFebMarAprMayJunJulAugSepOctNovDecserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_INITserver != 0sshfilexfers.cSsh2SftpServerReceived bad SSH_FXP_INITssh_file_server_receive_proc: bad INITnewline@vandyke.com server != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_OPENssh_file_server_receive_proc: bad OPENserver != 0sshfilexfers.cSsh2SftpServerReceived bad message %d.enReceived bad message %d.Ssh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_OPEN %sserver != 0sshfilexfers.cSsh2SftpServerUploading `%s' (flags %s%s%s%s)server != 0sshfilexfers.cSsh2SftpServerDownloading `%s'server != 0sshfilexfers.cSsh2SftpServerFailed to open file `%s'. Error %d.ensyserr: %s, file: %sserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_CLOSESsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_CLOSEssh_file_server_receive_proc: bad CLOSEenHandle not found.server != 0sshfilexfers.cSsh2SftpServer%s file `%s' (handle=%lx)enOKensyserr: %s, file: %sssh_file_server_receive_proc: bad READSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_READ: len %d, offset %denHandle not found.enSSH_FXP_READ from directory ``%s''enEncountered EOF.enread failed.ssh_file_server_receive_proc: bad WRITESsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_WRITE: len %d, offset %denHandle not found.enSSH_FXP_WRITE to directory ``%s''enwrite failed.enOKserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_STATssh_file_server_receive_proc: bad STATSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_STAT %sserver != 0sshfilexfers.cSsh2SftpServerStatting file `%s'ensyserr: %s, file: %sserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_LSTATssh_file_server_receive_proc: bad LSTATSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_LSTAT %sserver != 0sshfilexfers.cSsh2SftpServerLstatting file `%s'ensyserr: %s, file: %sSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_FSTATserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_FSTATssh_file_server_receive_proc: bad FSTATenHandle not found.enSSH_FXP_FSTAT for directory ``%s''server != 0sshfilexfers.cSsh2SftpServerFstatting file `%s' (handle=%lx)ensyserr: %s, file: %sserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_SETSTATssh_file_server_receive_proc: bad SETSTATSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_SETSTAT %sserver != 0sshfilexfers.cSsh2SftpServerSetstat file `%s' (%s%s%s%s)ensyserr: %s, file: %senOKSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_FSETSTATserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_FSETSTATssh_file_server_receive_proc: bad FSETSTATenHandle not found.enSSH_FXP_FSETSTAT for directory ``%s''server != 0sshfilexfers.cSsh2SftpServerFsetstat file `%s' (handle=%lx) (%s%s%s%s)ensyserr: %s, file: %senOKserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_OPENDIRssh_file_server_receive_proc: bad OPENDIRSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_OPENDIR undecoded %sSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_OPENDIR %sserver != 0sshfilexfers.cSsh2SftpServerOpening directory `%s'server != 0sshfilexfers.cSsh2SftpServerFailed to open dir `%s'. Error %d.ensyserr: %s, file: %sSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_READDIRserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_READDIRssh_file_server_receive_proc: bad READDIRenHandle not found.enSSH_FXP_READDIR and ``%s'' is not a directoryserver != 0sshfilexfers.cSsh2SftpServerReaddir on directory `%s' (handle=%lx)/%s%s/%s%d%d%3s %2d %2d:%02d%3s %2d %4d/ -> ???*%c%c%c%c%c%c%c%c%c%c %3d %-8s %-8s %8lu %12s %s%senEOFserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_REMOVEssh_file_server_receive_proc: bad REMOVESsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_REMOVE %sserver != 0sshfilexfers.cSsh2SftpServerRemoving file `%s'server != 0sshfilexfers.cSsh2SftpServerFailed to remove file `%s'. Error %d.ensyserr: %s, file: %senOKserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_MKDIRssh_file_server_receive_proc: bad MKDIRSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_MKDIR %sserver != 0sshfilexfers.cSsh2SftpServerCreating directory `%s'server != 0sshfilexfers.cSsh2SftpServerFailed to make dir `%s'. Error %d.ensyserr: %s, file: %senOKserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_RMDIRssh_file_server_receive_proc: bad RMDIRSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_RMDIR %sserver != 0sshfilexfers.cSsh2SftpServerRemoving directory `%s'server != 0sshfilexfers.cSsh2SftpServerFailed to remove dir `%s'. Error %d.ensyserr: %s, file: %senOKserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_REALPATHssh_file_server_receive_proc: bad REALPATHserver != 0sshfilexfers.cSsh2SftpServerResolving path to `%s'Ssh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_REALPATH: '%s' failedensyserr: %s, file: %sSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_REALPATH: '%s' resolved to '%s'server != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_RENAMEssh_file_server_receive_proc: bad RENAMESsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_RENAME %s to %sserver != 0sshfilexfers.cSsh2SftpServerRenaming `%s' to `%s'server != 0sshfilexfers.cSsh2SftpServerFailed to rename `%s'. Error %d.ensyserr: %s, file: %senOKserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_READLINKssh_file_server_receive_proc: bad READLINKSsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_READLINK %sserver != 0sshfilexfers.cSsh2SftpServerReading link `%s'server != 0sshfilexfers.cSsh2SftpServerReadlink failed for `%s'. Error %d.ensyserr: %s, file: %sserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_SYMLINKssh_file_server_receive_proc: bad RENAMESsh2SftpServersshfilexfers.cSsh2SftpServerSSH_FXP_SYMLINK %s with value %sserver != 0sshfilexfers.cSsh2SftpServerCreating link `%s' with value `%s'server != 0sshfilexfers.cSsh2SftpServerFailed to create symlink `%s'. Error %d.ensyserr: %s, file: %senOKserver != 0sshfilexfers.cSsh2SftpServerReceived SSH_FXP_EXTENDEDssh_file_server_receive_proc: bad EXTENDEDssh_file_server_receive_proc: unexpected packet: %denMessage type `%d' is not supported../a->allocated >= 0sshfastalloc.cSshFastallocblob_size > 0sshfastalloc.cSshFastallocblob_quant > 0sshfastalloc.cSshFastalloc%d blobs not freed in ssh_fastalloc_uninitializeSshADTMapsshadt_map.cSshADTMapmap cleared.SshADTMapsshadt_map.cSshADTMapInvoking callback @%p.SshADTMapsshadt_map.cSshADTMapCallback @%p returned.SshADTMapsshadt_map.cSshADTMapReference to non-existent callback (doing nothing).h != 0sshadt_map.cSshADTMapSshADTMapsshadt_map.cSshADTMapRehashing, old size %ld, new size %ld.SshADTMapsshadt_map.cSshADTMapi=%d (%d) [%p].c->f.app_methods.hash != 0sshadt_map.cSshADTMapSshADTMapsshadt_map.cSshADTMapInvoking callback @%p.SshADTMapsshadt_map.cSshADTMapCallback @%p returned.c->f.app_methods.hash != 0sshadt_map.cSshADTMapSshADTMapsshadt_map.cSshADTMapInvoking callback @%p.SshADTMapsshadt_map.cSshADTMapCallback @%p returned.c->f.app_methods.hash != 0sshadt_map.cSshADTMapSshADTMapsshadt_map.cSshADTMapInvoking callback @%p.SshADTMapsshadt_map.cSshADTMapCallback @%p returned.location == -3sshadt_map.cSshADTMapSshADTMapsshadt_map.cSshADTMapinserting %p failed (alloc).SshADTMapsshadt_map.cSshADTMapinserting %p failed (init).SshADTMapsshadt_map.cSshADTMapInvoking callback @%p.SshADTMapsshadt_map.cSshADTMapCallback @%p returned.SshADTMapsshadt_map.cSshADTMapReference to non-existent callback (doing nothing).SshADTMapsshadt_map.cSshADTMapInvoking callback @%p.SshADTMapsshadt_map.cSshADTMapCallback @%p returned.SshADTMapsshadt_map.cSshADTMapReference to non-existent callback (doing nothing).c->f.app_methods.hash != 0sshadt_map.cSshADTMapSshADTMapsshadt_map.cSshADTMapInvoking callback @%p.SshADTMapsshadt_map.cSshADTMapCallback @%p returned.0sshadt_map.cSshADTMapc->f.app_methods.hash != 0sshadt_map.cSshADTMapSshADTMapsshadt_map.cSshADTMapInvoking callback @%p.SshADTMapsshadt_map.cSshADTMapCallback @%p returned.c->f.app_methods.compare != 0sshadt_map.cSshADTMapSshADTMapsshadt_map.cSshADTMapInvoking callback @%p.SshADTMapsshadt_map.cSshADTMapCallback @%p returned.0sshadt_map.cSshADTMapSshADTMapsshadt_map.cSshADTMapDetach: handle=%pSshADTMapsshadt_map.cSshADTMapInvoking callback @%p.SshADTMapsshadt_map.cSshADTMapCallback @%p returned.SshADTMapsshadt_map.cSshADTMapReference to non-existent callback (doing nothing).ssh_buf_to_base64: internal error.SshPacketWrappersshpacketwrapper.cSshPacketWrapperWrote %ld bytes of data.ssh_packet_wrapper_input: invalid packet received: len %ld closing the offending input channeldata_to_read >= data_readsshpacketwrapper.cSshPacketWrapperssh_packet_wrapper_input: invalid packet received: len %ld closing the offending input channel.ssh_buffer_len(&down->incoming) == data_to_readsshpacketwrapper.cSshPacketWrapperssh_packet_wrapper_callback: disconnectedssh_packet_wrapper_callback: unknown op %dssh_packet_wrapper_send_encode_va: flow control problems; outgoing packet dropped.wrapper != 0sshpacketwrapper.cSshPacketWrapperssh_buffer_len(&up->incoming) == 0sshpacketimpl.cSshPacketImplementationssh_packet_impl_can_receive: not a SshPacketImpl streamssh_packet_impl_can_receive: not a SshPacketImpl streamssh_packet_impl_can_receive: not a SshPacketImpl streamssh_packet_impl_can_receive: not a SshPacketImpl streamssh_packet_impl_send_encode_va: flow control problems; outgoing packet dropped.ssh_packet_impl_send: buffer max size exceeded: size %ldssh_packet_impl_can_receive: not a SshPacketImpl streamssh_buffer_len(&up->incoming) == 0sshpacketimpl.cSshPacketImplementation%s%sCould not allocate memory for key expansionssh_hash_of_buffer: unsupported hash %.100smd51.2.840.113549.2.5sha11.3.14.3.2.26sha1-96sha1-80sha256sha256-96sha256-80ripemd1601.3.36.3.2.1ripemd160-96ripemd160-803des-cbcaes256-cbcaes192-cbcaes128-cbcblowfish-cbctwofish-cbctwofish256-cbctwofish192-cbctwofish128-cbcdes-cbc@ssh.comcast128-cbcarcfournonedesdes-cbc@ssh.comdes-cbcdes-cbc@ssh.com3des3des-cbccastcast128-cbcblowfishblowfish-cbctwofishtwofish-cbctwofish128twofish128-cbctwofish192twofish192-cbctwofish256twofish256-cbcrijndaelaes128-cbcaesaes128-cbcaes128aes128-cbcaes192aes192-cbcaes256aes256-cbclist_len > 0genciph.cSshGenCiphlist != 0genciph.cSshGenCiph%s%s%s%snoneinternal error: key expansion corrupted.keylen > 0arcfour.cArcFournonezlibSshBufZIPbufzip.cSshBufZIPSetting compression algorithm to %s, compression level %d1.1.41.1.4ssh_compress_allocate: bad method %dssh_compress_free: unknown method %d,!i->for_compressionbufzip.cSshBufZIPo->for_compressionbufzip.cSshBufZIPssh_zlib_compress: deflate returned Z_STREAM_ENDssh_zlib_compress: deflate returned Z_STREAM_ERRORssh_zlib_compress: deflate returned Z_BUF_ERRORssh_zlib_compress: deflate returned %dssh_zlib_uncompress: inflate returned Z_STREAM_ENDssh_zlib_uncompress: inflate returned Z_DATA_ERRORssh_zlib_uncompress: inflate returned Z_STREAM_ERRORssh_zlib_uncompress: inflate returned Z_MEM_ERRORssh_zlib_uncompress: inflate returned %dz->peer->peer == zbufzip.cSshBufZIPz->peer->method == SSH_COMPRESS_ZLIBbufzip.cSshBufZIPz->peer->for_compressionbufzip.cSshBufZIPSshBufZIPbufzip.cSshBufZIPadjusting compression level of outstream to %i.ssh_compress_buffer: unknown method %dhmac-md5hmac-md5-96hmac-sha1hmac-sha1-96hmac-sha256@ssh.comhmac-sha256-96@ssh.comhmac-ripemd160@ssh.comhmac-ripemd160-96@ssh.comnone%s%s%s%shmac-%ssignencryptdhsignencryptdhippssh_public_key_define: internal error.ippssh_private_key_get_info: cannot wrap.ssh_private_key_get_info: internal error.ippssh_public_key_get_info: cannot wrap.ssh_public_key_get_info: internal error.ssh_private_key_free: undefined key.SshCryptoRGFsshrgf.cSshCryptoRGFNo hash definition.SshCryptoRGFsshrgf.cSshCryptoRGFNo hash state.SshCryptoRGFsshrgf.cSshCryptoRGFNo hash state.SshCryptoRGFsshrgf.cSshCryptoRGFNo hash state.SshCryptoRGFsshrgf.cSshCryptoRGFNo hash state.SshCryptoRGFsshrgf.cSshCryptoRGFNo hash definition.pkcs1-sha1pkcs1-md5pkcs1-nonepkcs1v2-sha1pkcs1v2-md5pkcs1v2-nonestd-sha1pkcs1nopad-sha1std-md5pkcs1nopad-md5std-dummyssh_rgf_hash_update: no update function defined.ssh_rgf_hash_update_with_digest: no update function defined.ssh_rgf_hash_free: no hash free function defined.1.1.4SshMPIntegerCoresshmp-integer-core.cSshMPIntegerCoreOP= SshMPIntegerCoresshmp-integer-core.cSshMPIntegerCoreOP1= SshMPIntegerCoresshmp-integer-core.cSshMPIntegerCoreOP2= SshMPIntegerCoresshmp-integer-core.cSshMPIntegerCoreOP1= SshMPIntegerCoresshmp-integer-core.cSshMPIntegerCoreOP2= SshMPIntegerCoresshmp-integer-core.cSshMPIntegerCoreOP3= -,{}Pkcs1pkcs1.cPkcs1Couldn't init ASN.1 context.(sequence () (sequence () (object-identifier ()) (null ())) (octet-string ()))Pkcs1pkcs1.cPkcs1ASN.1 create node failed.Pkcs1pkcs1.cPkcs1ASN.1 encode failed.Pkcs1pkcs1.cPkcs1Couldn't init ASN.1 context.Pkcs1pkcs1.cPkcs1Couldn't ASN.1 decode the PKCS#1 blob..(sequence () (sequence () (object-identifier ()) (null ())) (octet-string ()))Pkcs1pkcs1.cPkcs1Invalid PKCS#1 BER structure.Pkcs1pkcs1.cPkcs1input len is too long: input_len = %u, len = %uPkcs1pkcs1.cPkcs1block type unknown %d.Pkcs1pkcs1.cPkcs1block type unknown %d.(sequence () (sequence () (object-identifier ()) (null ())) (sequence () (object-identifier ()) (sequence () (object-identifier ()) (null ()))) (sequence () (object-identifier ()) (octet-string ())))SshAsn1sshasn1.cSshAsn1BER: %s class %d encoding %d data (%d)SshAsn1sshasn1.cSshAsn1dataSshAsn1sshasn1.cSshAsn1Verifying the sortssh_asn1_node_compare(t, t->next) < 0sshasn1.cSshAsn1node->tag == 0sshasn1create.cSshAsn1CreateSshAsn1Createsshasn1create.cSshAsn1CreateASN.1 create node with format "%s"SshAsn1Createsshasn1create.cSshAsn1CreateASN.1 create tree with format "%s"SshAsn1Createsshasn1create.cSshAsn1CreateASN.1 read tree with format "%s"SshAsn1Createsshasn1create.cSshAsn1CreateASN.1 read node with format "%s"OkOk garbage at endBad garbage at endOperation failedConstructed assumedList emptyMissing closing markerFormat string too shortUnknown commandFormat string endedNode nullAll nullNo childNo parentBer open failedBer step failedBer close failedBer decode failedBer decode failedBuffer overflowBuffer too smallMatch not foundChoice too many matchesNot yet implementedUNKNOWN CODE, update ssh_asn1_error_codes table in asn1.cunivapplcontprivprimcnstdefindreservedbooleanintegerbit stringoctet stringnullobject identifierodeetirealenumembeddedutf8 stringreservedreservedreservedsequencesetnumeric stringprintable stringteletex stringvideotex stringia5 stringuniversal timegeneralized timegraphic stringvisible stringgeneral stringuniversal stringunrestricted stringbmp stringreserved "\ %c" : : %02x error: status %d %04u %s unknown class[%d] %s unknown encoding[%u] %s unknown length encoding[%d]: . %s*** universal, yet unknown *** %u ssh_ber_days_to_date: days could not be converted to date.%d/%d/%dn/ajanfebmaraprmayjunjulaugsepoctnovdec%04d %3s %2d%2s, %02d:%02d:%02d%04d/%02d/%02d/%02d:%02d:%02dstndrdthn/aJanFebMarAprMayJunJulAugSepOctNovDec%04d %s %2d%s, %02d:%02d:%02d GMT%s.ssh_ber_freelist_add: freelist not defined.%02d%02d%02d%02d%02d%02d.%lu%c%02d%02dZ%04d%02d%02d%02d%02d%02dZ%02u%02u%02u%02u%02u%02u%c.%lu%n%c%02d%02d%04u%02u%02u%02u%02u%02u%c%02d%02dssh_random_xor_noise: internal error.GenRandgenrand.cGenRandStarting read from /dev/random./dev/randomGenRandgenrand.cGenRandRead %ld bytes from /dev/random.GenRandgenrand.cGenRandOpening /dev/random failed.GenRandgenrand.cGenRandAlready acquiring noise.GenRandgenrand.cGenRandStarting to collect noise.ssh_random_get_byte: not enough space for random state.ssh_random_get_byte: internal error.SshObstacksshobstack.cSshObstackTried to allocate ZERO bytesSshObstacksshobstack.cSshObstackTried to allocate too much (%d bytes).ssh_mprzm_log: not yet implemented.ssh_mprzm_card: not yet implemented.ssh_rand: too narrow or invalid range ([%u,%u]).ssh_rand: too wide range ([%u,%u]).sieve != 0sshsieve.cSshMPSieve p00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0d0p0|000000Xbq} h 7 oo/0o// oo j p l p t |                     0 (0 4 < D  L  T  \  d  l  t  |   p 8 l  0 D X l x  p  ;| 0 <WH ` p]\ ^X Z [  0_ H \ad x px q  i4 @ Xi | l c  b @ Te ` pg x   (LTlt(08@hpHL   \ ` l t   l t     ( 0 |      H P  4@t|| (px$,4Pp  ,8HT p 40P`8th D8Hh|+x27((><LEhtIDI(J/01LXp  p4L`|    4 DP \ h  x !X  P   ""]##_8#0#H`#X#hi#|#f##m$##p #$j$ $k$$$8q$L$`q$x$q y ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~        )Cm y/ 4U]j?J!a idO)Bz k$$>@?CGlHJtL MOA<P P@PQ(PPUPWTtWD(: /0.+)'$-*%#!"( &$$$ % :2,1  /0.'$-%#!" &%%% % :35%4%VWXYDY<L\t " " " " " " " " " " " "KLTMLWX`Z [\]O(O]bac@ed KLTMLWX`Z [\]O(O]bac@ wx{||d  8 \  @6ccƄ||ww{{ kkֱooTőP00`gg}++Vb׵櫫MvvEʏ@ɉ}}YYGG 쭭AgԳ_꯯E#Srr[·uᮓ=j&&LZ66lA??~Õ\44hQ4qqsثS11b?* RǕe##F^Ý(07 / 6$=&i''NͲuu t,,X.4-6nnZZ[RRM;;vaַγ}{))R>q//^SShѹ,` @ȱy[[jjFˍپgK99rJJLLXXJυkл*媪OCCMMU33fEEPPD<KKܽa ppB>>|ĵqffHHaa_55jWWйiX':'8볘+3"iip٩3-"< I·UUx((PzߥY  ڿe1BBhhAA)w--Z˰{TTֻm:,ccƥ||ww{{ kkֽooޱőT00`PggΩ++V}׵bMvvʏEɉ@}}YYGG AԳg_Eꜜ#Srr[u=&&Lj66lZ??~ÃO44h\Q4qqثs11bS*? ǕR##FeÝ^0(7 / $6=&''Niuu ,,Xt4.6-nnܲZZ[RR;;vMַa}))R{>//^qSSѹh, @`y[[jjԾˍFg99rKJJLLXXυJлk*OCCMM33fUEEPP<!KKݽa܋ pp>>|Bqff̪HHaa£55j_WWiІX:''8+"3iiһ٩p3-<" ·IUU((PxߥzY e1BBhhиAAÙ)--Zw{TTm,:cƥc||ww{{ kֽkoޱoőT0`P0gΩg+V}+׵b׫MvvʏEʂɉ@}}YYGG AԳgԢ_Eꯜ#Srr[u·=&Lj&6lZ6?~A?̃O4h\4Q4qqثs1bS1*? ǕR#Fe#Ý^0(7 / $6=&'Ni'Ͳuu  ,Xt,4.6-nܲnZZ[RR;vM;ַaֳ}γ)R{)>/^q/SSѹh, @` yȱ[[jԾjˍF˾gپ9rK9JJLLXXυJлk*OCCMM3fU3EEPP!KKaܽ pp>|B>qĵf̪fHHa£a5j_5WWiйX:''8+"3iһi٩pَ3-<" ·IUU(Px(ߥzߌY  eڿ1BBhиhAA)-Zw-{˰TTmֻ,:ƥcc||ww{{ ֽkkޱooT`P00ΩggV}++bM櫫vvE@}}YYGG A쭭g_E꯯#Srr[u·=Lj&&lZ66~A??Oh\44Q4qqsbS11*? RFe##^0(7 / $6=&Ni''Ͳuu Xt,,4.6-ܲnnZZ[RRvM;;a}γR{))>^q//SSh,@` yȱ[[ԾjjFgپrK99JJLLXXJϻk*O媪CCMMfU33EEPPxD<<%K㨨QQ]@@?!pH88c߼wuBc!! 0mҁL &5/__5DD.9WU~~zG==Ȭdd]]2+ss``OODf""T~**; FF)kӸ(<y޼^^ v;dV22tN:: II Hl$$\\]½nCשּׁĦbb917yy2CnY77ڷmmd՜NNI੩شllVV%ʯeezzG鮮oպxxJo%%\r..8$WsǴQ#|tt>!KKaܽ pp|B>>qĵ̪ffHH£aaj_55WWiйX:''8+"3һiip3-<" IΪUUPx((zY  eڿ1BBиhhAA)Zw--{˰TTmֻ,:PQSeA~ä^':k;EXKU0 mvv̈%LO*ŀD5&bIZg%E]u/LFk_zmYR-!tX)iIDɎjuxyk>Xq'Of ɴ:}Jc1`3QESbwdk+XhHpElޔ{R#sKrW*Uf(µ/{ņ7(0#j\+ϊyiNeվb4ъĝS.4U2u9 `@q^Qn!>=ݖ>FMT]qoP`$C@wgB谈8[yG |B| H+2pNrZlV8ծ='9-6d !\hT[:.6$g WҖO aiKwZ *C"< Nj򹨶-ȩWLuݙ`&r\;fD4~[v)C#hc1cB@" Ƅ}$J=2m)K/0R wl+pH"dGČ?,}V3"NI8ʌ6 Ԙρ(z&ڤ?:, xP_jbF~Tؐ^9.Â]|i-o%;ȧ}nc{; x&Yn쨚Oen~ϼ!ٛ6oJ |)11#?*0f57NtʂАا3JAP/MvMCTMўjL,QeF^]5st.A ZgRے3VGmaךz 7Y<'5ah,4$8_@r %⼋I<(A q9޳ ؐVda{p2t\lHBWЧQPeA~S^':k;EXK0 Umvv̈L%O*D5&bZI%gE]u/LFk_眒zmYRڃ-!tXiI)ɎDujyx>Xkq'Oᾶ f:}Jc13Q`SbEwdk+hHpXElޔ{Rs#KrWUf*(µ/{ņ7ӥ(0#j\ϊ+yiNe;b4ĊS.4U2u 9`@q^nQ!>ݖ=>ݮMFT]qoP`$֗C@̞gwB谽[8y |GB| +2HprZlN8Vծ=9-6' d\h!T[.6$:g WґO aKwZi *"4$8,@_r% I<( A9q ؜Vd{a2p\lHtWBQPA~Seä':^;kEXK0 Uvm̈v%LO*5&DbIZ%gE]/uLFk_mzRY-tX!I)iɎDujxyXk>'qᾶO f}:cJ1Q`3SbEdwk+HpXhEޔl{Rs#KrWUf*(/ņ{7ӥ(0#j\ϊ+yiNeվ4bĊ.4SU2u 9`@q^nQ!>ݖ=>ݮMFTq]oP`$֗@Cgw谽B8[y|G B| +2HpZlNrV8=-6'9 d\h![T6$:. gWҖOa wZiK *"$8,4_@r %<(I A9q ޳؜Vd{a2plHt\BWQP~SeAä:^';kEXK U0mvv%LO*&D5bIZ%gE]u/LFk_zmYR-X!tI)iDujxyk>X'qOf }:cJ1`3QbESwdk+pXhHElR{#srKWf*U(/µ{ӥ70(#j\+ϧyNieվb4Ċ4S.U2ኤu 9@`^qQn>!=ݮ>MF摵Tq]o`P$֗齉C@gwٰB8[yȡG ||B 2H+plNrZV8=ծ6'9- dh!\T[$:.6 g WҖOa ZiKw *h8,4$_@r %(IfHa5WiU( BhA-Tc|w{ko0g+v}YGr&6?4q1#'u ,nZR;)/S [j9JLXCM3EP<Q@8! _D~=d]s`O"*F^ 2: I$\by7mNlVezx%.tKp>fHa5WiU( BhA-Tc|w{ko0g+v}YGr&6?4q1#'u ,nZR;)/S [j9JLXCM3EP<Q@8! _D~=d]s`O"*F^ 2: I$\by7mNlVezx%.tKp>fHa5WiU( BhA-Tc|w{ko0g+v}YGr&6?4q1#'u ,nZR;)/S [j9JLXCM3EP<Q@8! _D~=d]s`O"*F^ 2: I$\by7mNlVezx%.tKp>fHa5WiU( BhA-TR j068@|9/4CDT{2#=L BN.f($v[Im%rdh\]elpHP^FW XE,?k:AOgst"57unGq)obV>Ky xZ31Y'_`QJ -z;M*<Sa+~w&icU! }R j068@|9/4CDT{2#=L BN.f($v[Im%rdh\]elpHP^FW XE,?k:AOgst"57unGq)obV>Ky xZ31Y'_`QJ -z;M*<Sa+~w&icU! }R j068@|9/4CDT{2#=L BN.f($v[Im%rdh\]elpHP^FW XE,?k:AOgst"57unGq)obV>Ky xZ31Y'_`QJ -z;M*<Sa+~w&icU! }R j068@|9/4CDT{2#=L BN.f($v[Im%rdh\]elpHP^FW XE,?k:AOgst"57unGq)obV>Ky xZ31Y'_`QJ -z;M*<Sa+~w&icU! } P< PD ` ,  L `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`* * Ѡ * p *  * \ p* Ѡ + Ѡ + Ѡ +, Ѡ +8  +L Ѡ +\+h+t + ͨ +  + Ѡ + Ѡ + Ѡ ++ ͨ +  + Ѡ +++ Ѡ ,   !=RTr vW6Ϩ qN^WPL%q{w@0a>'a 1o? W7rsykiB݌&2t&c'u10zr0\N½9'9 8{9)u ', where is one of the following commands: open lopen close quit cd lcd pwd lpwd ls lls get mget put mput rm lrm mkdir lmkdir rmdir lrmdir rename lrename readlink lreadlink symlink lsymlink ascii binary auto setext getext lsroots debug verbose help openopen [ | -l ] Tries to connect to the host . Or with the -l option, connects the remote side to the local filesystem (which doesn't require a server). lopenlopen [ | -l ] Tries to connect the local side to the host . If successful, "lls" and friends will show the contents of the filesystem on that host. With the -l option, connects to the local filesystem (which doesn't require a server). closeclose Closes the remote connection. lcloselclose Closes the local connection. quitquit Quits the application. cdcd Changes the current remote working directory. lcdlcd Changes the current local working directory. pwdpwd Prints the name of the current remote working directory. lpwdlpwd Prints the name of the current local working directory. lsls [ -R ] [ -l ] [-S] [-r] [ ... ] Lists the names of files on the remote server. For directories, contents are listed. When the -R is given, directory trees are listed recursively. (By default, subdirectories of the arguments are not visited.) When the -l option is given, permissions, owners, sizes and modification times are also shown. When given no arguments, assumes that the contents of . are being listed. If -S is given, sorting is done based on file sizes (default: alphabetically). If -r is given, the sort order is reversed. llslls [ -R ] [ -l ] [ ... ] Same as ls, but operates on the local files. getget [--preserve-attributes] [-p] [ ... ] Transfers the specified files from the remote end to the local end. Directories are recursively copied with their contents. If -p,--preserve-attributes is given, sftp tries to retain permissions and timestamps. mgetmget [options] [ ... ] Synonymous to get. putput [options] [ ... ] Transfers the specified files from the local end to the remote end. Directories are recursively copied with their contents. Options are the same as for get. mputmput [options][ ... ] Synonymous to put. rmrm Tries to delete the file specified in .lrmlrm Same as rm, but operates on the local files. mkdirmkdir Tries to create the directory specified in lmkdirSame as mkdir, but operates on the local files. rmdirrmdir Tries to delete the directory specified in lrmdirSame as rmdir, but operates on the local files. renamerename Tries to rename the to . If already exists, the files are left intact. lrenameSame as rename, but operates on the local files. readlinkreadlink Provided that is a symbolic link, shows where the link is pointing to. lreadlinkSame as readlink, but operates on the local files. symlinksymlink Creates symbolic link , which will point to . lsymlinkSame as symlink, but operates on the local files. asciiascii [-s] [] [] With -s option, shows current newline convention. sets remote newline convention. operates on local side, but is not as useful (the correct local newline convention is usually compiled in, so this is mainly for testing). Please note, that these are only hints for the underlying transfer layer, which tries to use the newline convention given by the server wherever possible. You can set either of these to "ask", which will cause sftp to prompt you for the newline convention when needed. With the exception of "-s" option, this command sets transfer mode to ascii. Available conventions are "dos", "unix" or "mac", using "\r\n", "\n" and "\r" as newlines, respectively. binarybinary Files will be transfered in binary mode. autoauto File transfer mode will be selected automatically from the file extension. setextsetext [ ... ] Sets the file extensions that will be ascii in the auto transfer mode. Normal zsh-fileglob regexs can be used in the file extensions. getextgetext Displays the extensions that will be ascii in the auto transfer mode. lsrootslsroots Dumps the virtual roots of the server (this is a VShell extension. Without this you can't know the filesystem structure of a VShell server). setpermsetperm Set the default file/dir permission bits for upload. (Prefix fileperm with 'p' to preserve permission of existing files or dirs.) debugdebug [disable | no | ] With "disable" or "no", disables debugging. Otherwise, sets as debug level string, as per command-line option "-D". verboseverbose Enables verbose mode (identical to "-D 2" command-line option). You may later disable verbose mode by 'debug disable'. helphelp [ ] If is not given, lists the available topics. If is given, outputs available online help about the topic. SSH Secure Shell 3.2.9.1 (non-commercial version)sparc-sun-solaris2*?[](|)#*?[](|)#SSH_FC_OKSSH_FC_ERRORSSH_FC_ERROR_DEST_NOT_DIRSSH_FC_ERROR_ELOOPSSH_FC_ERROR_CONNECTION_FAILEDSSH_FC_ERROR_CONNECTION_LOSTSSH_FC_ERROR_NO_SUCH_FILESSH_FC_ERROR_PERMISSION_DENIEDSSH_FC_ERROR_FAILURESSH_FC_ERROR_PROTOCOL_MISMATCHSSH_FC_ERROR_NO_MATCHremote host 'local'NULLNULLNULLETATOCfcg_next_fileSet next file to globfcg_readyGlobbing readyfcg_finishFinish`' ()srcdst(server msg: '')srcdst(server msg: '')srcdst(server msg: '')srcdst(server msg: '')srcdst(server msg: '')srcdst(server msg: '')srcdstsrcdstsrcdst/TRUEFALSEfct_check_src_connCheck source connectionfct_check_dest_connCheck destination connectionfct_conn_failedConnection has failedfct_stat_dest_locStat destination location.fct_stat_srcStat source filefct_stat_destStat destination filefct_rm_srcRemove source filefct_open_destOpen destination filefct_open_srcOpen source filefct_chmod_destChange permissions of dest filefct_set_attrsTruncate and change access and modification timesfctc_start_transferPrepare everything for the actual transferfctc_start_transfer_finalizeFinalize initializationfctc_shredShred file to requestsfctc_read_inTry to read filefctc_write_outTry to write data to filefctc_finishFinish threadfctc_readwrite_errorUn-recoverable error during actual transferfctc_mangleMangle filefctc_get_source_newlineGet source newline conventionfctc_get_dest_newlineGet source dest conventionfct_mkdirMake a new directoryfct_chmod_dest_dirChange permissions and fileattributes of destination directoryfct_rm_src_dirRemove source directoryfct_walk_file_listGet next file in file listfct_prepare_base_dirPrepare base directoryfct_start_file_opsStart operations on filefct_walk_treeGet next file in directory entry listfct_dir_descentGo down on directory hierarchyfct_core_startStart the actual transferfct_close_srcClose source filefct_close_destClose destination filefct_doneTransfer donefct_cleanupDo cleanupfct_finish_threadFinish this threadfct_abortAbort file transfer exchange(server msg: '')got EOF writing fileunsupported operationno such filepermission deniedprotocol errorundefined errorconnection lostout of memory(server msg: '')`' ()srcdst(server msg: '')srcdst(server msg: '')srcdst(server msg: '')srcdst(server msg: '')srcdst(server msg: '')srcdst(server msg: '')srcdstsrcdstsrcdstfcr_check_connCheck connectionfcr_walk_file_listTraverse given file listfcr_process_locationProcess filefcr_parse_rawParse "raw" filefcr_walk_treeGo through items in file listfcr_opendirOpen a directoryfcr_readdirTake next directory elementfcr_lstatlstat filefcr_statlstat filefcr_finish_threadFinish this threadfcr_recurse_doneWe're done recursingfcr_cleanupClean up 0123456789abcdef0123456789ABCDEFambiguousinvalidunknown*?+???/?*?+???}?**/##amsmkxsmkxrmkxrmkxelelhpahpadchdchdch1dch1ichichich1ich1cudcudcud1cud1cubcubcub1cub1cufcufcuf1cuf1cuucuucuu1cuu1flashflashkcud1kcud1kcub1kcub1kcuf1kcuf1kcuu1kcuu1[%dB[%dD[%dC[%dAOBODOCOAfile-content-hash-1@ssh.comnewline@vandyke.com append trunc creat exclClosedReceived error when closingsize uidgid permsacmodtimesize uidgid permsacmodtime./,,,,,plain1.1.41.1.4unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version1.2.840.113549.1.1.81.2.840.113549.1.1.9invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatinvalid literal/length codeinvalid distance codeinvalid distance codeinvalid literal/length codeoversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsOKFAILUREbooleangeneral-stringbit-stringobject-identifiernullprintable-stringunrestricted-stringgraphic-stringia5-stringgeneralized-timevisible-stringsequenceoptionalutc-timeenumenum-shortbmp-stringuniversal-stringteletex-stringchoiceintegerinteger-shortutf8-stringanysetoctet-stringempty stndrdthcg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)ioctl.h 1.9 92/07/14 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)syslog.h 1.11 96/05/17 SMI@(#)syslog.h 1.10 92/07/14 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)ioctl.h 1.9 92/07/14 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)ioctl.h 1.9 92/07/14 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)ioctl.h 1.9 92/07/14 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)socket.h 1.57 01/09/28 SMI@(#)uio.h 1.30 01/03/19 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)in.h 1.36 02/10/02 SMI@(#)stream.h 1.92 03/01/28 SMI@(#)vnode.h 1.96 03/03/11 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.22 01/10/31 SMI@(#)privregs.h 1.5 99/06/05 SMI@(#)psr.h 1.3 96/09/12 SMI@(#)fsr.h 1.3 97/02/11 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/01/29 SMI@(#)rwstlock.h 1.2 03/03/11 SMI@(#)ksynch.h 1.6 97/10/22 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)seg_enum.h 1.7 00/05/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.21 01/08/31 SMI@(#)strft.h 1.2 00/03/17 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)termio.h 1.8 93/02/04 SMI@(#)termio.h 1.11 96/02/07 SMI@(#)curses.h 1.29 98/07/16 SMI@(#)widec.h 1.22 99/04/14 SMI@(#)euc.h 1.8 96/06/26 SMI@(#)euc.h 1.11 93/02/01 SMI@(#)wchar.h 1.35 01/10/17 SMI@(#)wchar_iso.h 1.2 99/11/10 SMI@(#)wchar_impl.h 1.3 99/07/26 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMI@(#)unctrl.h 1.7 93/02/04 SMI@(#)term.h 1.20 99/03/04 SMI@(#)ioctl.h 1.9 92/07/14 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)ioctl.h 1.9 92/07/14 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12acomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)stddef.h 1.16 99/08/10 SMI@(#)stddef_iso.h 1.1 99/08/09 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12cg: Sun Compiler Common 7.1 2003/03/12@(#)types.h 1.74 03/08/07 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.17 01/08/15 SMI@(#)time.h 2.70 02/01/28 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.7 01/09/06 SMI@(#)stat.h 1.3 01/07/29 SMI@(#)stat_impl.h 1.2 01/07/29 SMI@(#)param.h 1.77 02/01/22 SMI@(#)unistd.h 1.39 01/07/29 SMI@(#)limits.h 1.52 02/01/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)stdio.h 1.79 01/04/16 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.13 01/02/08 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.13 01/11/16 SMI@(#)ctype.h 1.33 99/08/10 SMI@(#)ctype_iso.h 1.1 99/08/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/01/12 SMI@(#)fcntl.h 1.15 01/07/29 SMI@(#)fcntl.h 1.48 01/12/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)signal.h 1.39 01/11/07 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.2 01/04/05 SMI@(#)signal.h 1.56 01/05/28 SMI@(#)siginfo.h 1.55 01/04/05 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/01/11 SMI@(#)stdlib.h 1.48 00/04/13 SMI@(#)stdlib_iso.h 1.3 01/03/09 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.60 01/07/29 SMI@(#)resource.h 1.27 01/04/05 SMI@(#)times.h 1.10 97/08/12 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)grp.h 1.18 96/03/12 SMI@(#)dirent.h 1.31 01/07/29 SMI@(#)dirent.h 1.32 99/05/04 SMI@(#)wait.h 1.21 97/04/08 SMIacomp: Sun C 5.5 2003/03/12iropt: Sun Compiler Common 7.1 2003/03/12ld: Software Generation Utilities - Solaris Link Editors: 5.9-1.378.interp.hash.dynsym.dynstr.SUNW_version.rela.data.rela.bss.rela.plt.text.init.fini.rodata.rodata1.got.plt.dynamic.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstr 60 77lP"hho/0/0-B//  8B//0 BB// L55]$R X ^ bf uSo j jt j j y p p q q h h2,( ,( ,#k